KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500010
Entry
107500010         CDS       T06036                                 

Gene name
STAG3
Definition
(RefSeq) cohesin subunit SA-3 isoform X1
  KO
K13055  cohesin complex subunit SA-3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107500010 (STAG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107500010 (STAG3)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Meiosis-specific sister chromatid cohesion proteins
   Cohesin complex
    107500010 (STAG3)
SSDB
Motif
Pfam: STAG Cnd1
Other DBs
NCBI-GeneID: 107500010
NCBI-ProteinID: XP_015980274
LinkDB
Position
Unknown
AA seq 1263 aa
MMVVTFPQPCSARSRCSGLRHWTTMPTLRSSSSLLHSSSSPSSVSSPLQRAMRGGQKGLS
TSSSLSVSVPFDDRDSDQIKEGDSDSLSTDEGSDFEDSLRHNMKKRAAKRPLKTTPVAKH
PKKGSRMVHGRSQKESEPPASDLFDAVRAAKSDMQSLVDEWLESYKQDQDAGFLELINFF
IRSCGCKGTVTPEMFKKMSNSEIIRHLTEQFNEDSGDYPLTAPGPSWKKFQGSFCEFVRT
LVYQCQYSLLYDGFPMDNLISLLTGLSDSQVRAFRHTSTLAAMKLMTSLVRVALQLSLHK
DNNQRQYEAERNKGPEQRAPERLESLLEKRKELQEHQEEIEGMMNALFRGVFVHRYRDVL
PEIRAICIEEIGSWMQNYSTSFLTDSYLKYIGWTLHDKHREVRLKCLKALKGLYSNRDLT
ARLELFTSRFKDRMVSMVMDREYDVAVEAVRLLILILKNMEGVLTDADCESIYPVVYASN
RALASAAGEFLYWKLFYPECETRTVGEKERRRSPCAQKTFFHLLLSFFVESELHNHAAYL
VDSLWDCAGSQLKDWESLTSLLLEKDQNLGDVQESTLIEILVSSIRQASEGHPPVGRVTG
RKGLTPKERKIQADDKVKLTEHLIPLLPQLLAKFSADAEKVAPLLQLLNYFDLNIYCTRR
LEKHLELFLQQLQEVVVKHAEPVVLEAGAHALYLLCNPEFTFFSRVDFARSQLVDLLTDR
FQQELEELLQSSFLDEDEVYSLTATLKRLSAFYNAHDLTRWELYEPCYRLLRKAVDTGEI
PHQVILPALTLVYFSILWTLTHLSGSGASQKQLLNLKGRMVAFCELCQSCLSDVDPEIQE
QAFVLLSDLLLIFSPQMTVGGRDFLRPLVFLPEATLQSELASFLMDHVFIEPGELGRGHS
QEDHLQIEQLHQRRRLLAGFCKLLLYGVLEMDAASDVFKHYNKFYNDYGDIIKETLTRAR
QIDRSHCSRILLLSLKQLYTELLQEQGPQDLNELPAFIEMRDLARRFALSFGPQQLQNRD
LIVMLHKEGIKFSLSELPPAGSSGQPPNLAFLELLSEFSPRLFHQDKKLLLSYLEKCLQR
ISQAPGHPWGPVTTYRHSLSPVENTAEASPQGYPHSKKRRIEGSSRRHREDTSSSQEESL
PLNSIPPTPTLTSTAVKSRQPPGGLEEIEEEEGLESKFTQGQPLSDTQKSRFSSPQHFHT
PLNPSGPGLGNRLTRLSLMEEDEEELEIQNESGEEWQDPDKHSSPSEPGLDLLDSTELNV
EDF
NT seq 3792 nt   +upstreamnt  +downstreamnt
atgatggtggtgacttttcctcaaccgtgctcagccagaagtcgttgttccggactcaga
cactggaccaccatgcctacccttcgatcctcctcctccttgctccatagctcctcctct
ccaagcagtgtgtcctctccactgcaacgagcaatgagaggtggacagaagggcttgtct
acatcttctagtttgtctgtcagtgtgccctttgatgacagggactcggaccagattaaa
gagggggatagtgattctttatcaactgatgaaggcagtgacttcgaagacagcttgaga
cacaacatgaagaagagagcagcaaaacgaccactcaaaacaaccccagtggcaaaacat
ccaaagaaggggtcccgaatggtacatggtcgtagccagaaagagtcagagccaccagcc
agcgatctttttgatgctgtgagagctgccaaaagtgacatgcagtctctggtggatgag
tggctggagagctacaagcaagaccaagatgcaggattcctggagctcattaactttttc
atccgatcttgtggatgtaaaggcactgtgacccccgagatgttcaagaagatgtccaac
tcagagatcatccggcacctaacagaacagtttaatgaggactcaggagactatcccctg
acagctccaggtccatcctggaagaagttccagggaagtttttgtgaatttgtgaggaca
ttggtctaccagtgccagtacagcctcctttatgatggcttccctatggacaacctcatt
tccctgctcactggcctctcagactcccaagtccgtgccttccgtcacactagcacattg
gctgccatgaaactaatgacctctctggtacgagttgccctccaactgagtttgcacaaa
gacaacaatcagcgtcagtatgaggctgaacgaaacaaggggccagaacagagagcacct
gagcggctggagagcctgttggagaaacgcaaagagctccaagagcatcaagaggagatt
gaggggatgatgaatgccctcttcaggggtgtctttgtacatcggtacagagatgtcctt
cctgagattcgtgctatctgcatcgaggagattgggtcttggatgcaaaactacagtacc
tccttcctcactgacagttatttaaaatatattggctggaccctgcatgataagcatcgg
gaagtccgcctaaagtgcctgaaggctctcaaaggactgtacagcaaccgggacttaact
gcacgcctggagctctttactagccgcttcaaggaccggatggtttccatggtcatggac
cgagagtatgatgtggcagtggaggccgtcaggttgctaatacttatccttaagaacatg
gaaggggtgctgacagatgctgactgtgagagtatctatcctgttgtgtatgcctctaat
cgagccctggcctctgctgcaggggaatttctatactggaagctcttttaccctgagtgt
gagacgagaacagtgggtgagaaagagcgacgccgaagtccatgtgcccagaagactttc
ttccaccttctgctgtccttctttgtggagagtgagctccataaccatgctgcttactta
gtagacagcttgtgggactgtgcggggtctcagctgaaggactgggagagtctgacaagt
ttgctactggagaaggaccagaacctgggcgatgtgcaggagagcacgctgatagaaatc
cttgtgtccagtatccggcaagcttcagagggtcacccccctgtgggacgggtcactggg
aggaagggcttaacccctaaagaacgtaagatccaagcggatgacaaggtgaagctgact
gagcacctcattcccctgctaccccagctcctggccaagttctcagctgatgcagagaag
gttgctcccctgcttcagcttctcaactactttgacctcaacatctactgcaccaggcgc
ttggagaagcacctggagctgttcttgcagcaactccaggaagtggtggtgaagcatgca
gagccagtggtgcttgaggctggagctcacgccctctatctgctctgtaatcctgagttc
acgttctttagccgggtggactttgcccgcagccagttggtggatctgctgactgaccgc
ttccagcaagaacttgaagagctgctgcagtcatccttcctagatgaggatgaggtgtac
agtctgacagccactctgaagcgcctctctgccttttacaatgctcatgacctaacacgc
tgggagctctatgaaccatgctaccgactcctccggaaggctgtggacacaggagagatt
cctcaccaggtgatcctgccagctctgactcttgtctatttttccatcctctggacacta
acccacctttctggatcaggtgcttcccagaagcagctattgaacttgaagggcagaatg
gtggccttctgtgaactttgccagagctgcctctcagatgtggatcctgagatccaggag
caggctttcgtcttattaagtgatctacttctcatcttcagccctcagatgactgtaggg
ggacgtgatttccttaggcctcttgtctttcttcctgaagccactctccagtctgagcta
gccagcttcctcatggaccacgtcttcatcgagcctggagaactgggcaggggtcattcc
caggaggaccatttacagatagagcaactgcaccagcggcgtcgcctcctggccgggttc
tgcaagctgttactttatggggtcctggagatggatgcagcttcagatgttttcaaacat
tataacaagttttacaatgactatggtgacattatcaaggaaacattaacaagagcgaga
cagattgaccgaagtcattgttcccgaatcctgctgctaagcctcaagcagttgtacaca
gaactgctgcaggaacaggggccccaggacctgaatgagcttccagccttcattgagatg
agggacttggcccgaaggtttgccctgagctttggaccccaacagctacagaaccgtgac
cttatagtcatgctacacaaggaaggcatcaagttctccttgtctgagcttcctccagct
ggctcctccggtcagcccccaaacctagcattcctggagctcctttcagagttctccccc
cgactcttccatcaggacaagaagctgctactgtcctacctggaaaagtgtctgcagcgt
atctcccaggcacctggccatccctggggtccagtcaccacctatcgccactccctcagt
cctgtagagaacacagcagaggccagccctcagggctatccccactccaagaaaaggcgt
attgaaggctcctccaggcggcacagagaggacacctcttcatctcaggaggaaagccta
cctctgaacagcatcccacccacacccacccttacctccacagctgtgaagagtaggcag
cccccggggggcttggaagagatagaagaagaagaaggcttagaatcaaagtttacccaa
ggccagcccctttcagatacccagaagtcaaggttttcgagtccacagcattttcatact
ccactcaatccttcaggtcctggtctgggcaatcggctgactcgactcagccttatggaa
gaggatgaagaggagttagaaattcagaatgaatcaggtgaagaatggcaagatccagac
aagcactcttcccccagtgagcctgggctggacctcttagattctacagagctgaatgtt
gaggatttctga

DBGET integrated database retrieval system