KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500067
Entry
107500067         CDS       T06036                                 

Gene name
GNAS
Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoform X1
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04072  Phospholipase D signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04962  Vasopressin-regulated water reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
ray05012  Parkinson disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05032  Morphine addiction
ray05034  Alcoholism
ray05142  Chagas disease
ray05146  Amoebiasis
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107500067 (GNAS)
   04020 Calcium signaling pathway
    107500067 (GNAS)
   04072 Phospholipase D signaling pathway
    107500067 (GNAS)
   04024 cAMP signaling pathway
    107500067 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107500067 (GNAS)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107500067 (GNAS)
  09152 Endocrine system
   04911 Insulin secretion
    107500067 (GNAS)
   04922 Glucagon signaling pathway
    107500067 (GNAS)
   04923 Regulation of lipolysis in adipocytes
    107500067 (GNAS)
   04912 GnRH signaling pathway
    107500067 (GNAS)
   04913 Ovarian steroidogenesis
    107500067 (GNAS)
   04915 Estrogen signaling pathway
    107500067 (GNAS)
   04921 Oxytocin signaling pathway
    107500067 (GNAS)
   04926 Relaxin signaling pathway
    107500067 (GNAS)
   04935 Growth hormone synthesis, secretion and action
    107500067 (GNAS)
   04918 Thyroid hormone synthesis
    107500067 (GNAS)
   04928 Parathyroid hormone synthesis, secretion and action
    107500067 (GNAS)
   04916 Melanogenesis
    107500067 (GNAS)
   04924 Renin secretion
    107500067 (GNAS)
   04925 Aldosterone synthesis and secretion
    107500067 (GNAS)
   04927 Cortisol synthesis and secretion
    107500067 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107500067 (GNAS)
   04270 Vascular smooth muscle contraction
    107500067 (GNAS)
  09154 Digestive system
   04970 Salivary secretion
    107500067 (GNAS)
   04971 Gastric acid secretion
    107500067 (GNAS)
   04972 Pancreatic secretion
    107500067 (GNAS)
   04976 Bile secretion
    107500067 (GNAS)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107500067 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    107500067 (GNAS)
  09156 Nervous system
   04724 Glutamatergic synapse
    107500067 (GNAS)
   04728 Dopaminergic synapse
    107500067 (GNAS)
   04726 Serotonergic synapse
    107500067 (GNAS)
   04730 Long-term depression
    107500067 (GNAS)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107500067 (GNAS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107500067 (GNAS)
   04714 Thermogenesis
    107500067 (GNAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107500067 (GNAS)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107500067 (GNAS)
  09165 Substance dependence
   05030 Cocaine addiction
    107500067 (GNAS)
   05031 Amphetamine addiction
    107500067 (GNAS)
   05032 Morphine addiction
    107500067 (GNAS)
   05034 Alcoholism
    107500067 (GNAS)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107500067 (GNAS)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107500067 (GNAS)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107500067 (GNAS)
   05165 Human papillomavirus infection
    107500067 (GNAS)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107500067 (GNAS)
   05142 Chagas disease
    107500067 (GNAS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107500067 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107500067 (GNAS)
   04031 GTP-binding proteins [BR:ray04031]
    107500067 (GNAS)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107500067 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   107500067 (GNAS)
  Exosomal proteins of colorectal cancer cells
   107500067 (GNAS)
  Exosomal proteins of bladder cancer cells
   107500067 (GNAS)
GTP-binding proteins [BR:ray04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    107500067 (GNAS)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc GTP_EFTU
Other DBs
NCBI-GeneID: 107500067
NCBI-ProteinID: XP_015980378
LinkDB
Position
Unknown
AA seq 362 aa
MEDAVQILLVFFDSGAGESGKSTIVKQMRILHVNGFNGEGGEEDPQAARSNSDGEKATKV
QDIKNNLKEAIETIVAAMSSLVPPVELANPENQFRVDYILSVMNVPDFDFPPEFYEHAKA
LWEDEGVRACYERSNEYQLIDCAQYFLDKIDVIKQADYVPSDQDLLRCRVLTSGIFETKF
QVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVVASSSYNMVIREDNQTNRLQEALNL
FKSIWNNRWLRTISVILFLNKQDLLAEKVLAGKSKIEDYFPEFARYTTPEDATPEPGEDP
RVTRAKYFIRDEFLRISTASGDGRHYCYPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYE
LL
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggaggacgccgtccagattctccttgttttctttgattcaggtgctggagaatctggt
aaaagcaccattgtgaagcaaatgaggatcctgcatgttaatgggtttaatggagagggc
ggcgaagaggacccgcaggctgcgaggagcaacagcgatggtgagaaggccaccaaggtg
caggacatcaagaacaacctgaaggaggccatcgaaaccatcgtggccgccatgagcagc
ctggtgccccccgtggagctggccaaccctgagaaccagttcagagtggactacatcctg
agcgtgatgaacgtgccggactttgacttccctcccgaattctacgagcacgccaaggct
ctgtgggaggacgagggcgtccgcgcctgctacgagcgctccaacgagtaccagctgatc
gactgcgcccagtacttcctggacaagatcgatgtcatcaagcaggccgactacgtgccc
agcgaccaggacctgcttcgctgccgcgtcctgacctctgggatctttgagaccaagttc
caggtggacaaagtcaacttccacatgttcgacgtgggtggccagcgcgatgagcgccgc
aagtggatccaatgcttcaacgatgtgaccgccatcatcttcgtggtggccagcagcagc
tacaacatggtcattcgggaggacaaccagaccaaccgcctgcaggaggctctgaacctc
ttcaagagcatctggaacaacagatggctgcgcaccatctctgtgatcctgttcctcaac
aagcaagatctgctcgccgagaaggtgctcgcggggaagtccaagatcgaggactacttc
cccgagtttgcgcgctacactactcctgaggatgctactcccgagcccggagaggacccg
cgtgtgacccgggccaagtacttcatccgcgacgagttcctgagaatcagcaccgccagt
ggggacgggcgccactactgctacccccacttcacctgcgccgtggacaccgagaacatc
cgccgcgtgttcaacgactgtcgcgacatcatccagcgcatgcacctgcgccagtacgag
ctgctgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500068
Entry
107500068         CDS       T06036                                 

Definition
(RefSeq) neuroendocrine secretory protein 55-like
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04072  Phospholipase D signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04714  Thermogenesis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04926  Relaxin signaling pathway
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04962  Vasopressin-regulated water reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray04976  Bile secretion
ray05012  Parkinson disease
ray05030  Cocaine addiction
ray05031  Amphetamine addiction
ray05032  Morphine addiction
ray05034  Alcoholism
ray05142  Chagas disease
ray05146  Amoebiasis
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107500068
   04020 Calcium signaling pathway
    107500068
   04072 Phospholipase D signaling pathway
    107500068
   04024 cAMP signaling pathway
    107500068
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107500068
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107500068
  09152 Endocrine system
   04911 Insulin secretion
    107500068
   04922 Glucagon signaling pathway
    107500068
   04923 Regulation of lipolysis in adipocytes
    107500068
   04912 GnRH signaling pathway
    107500068
   04913 Ovarian steroidogenesis
    107500068
   04915 Estrogen signaling pathway
    107500068
   04921 Oxytocin signaling pathway
    107500068
   04926 Relaxin signaling pathway
    107500068
   04935 Growth hormone synthesis, secretion and action
    107500068
   04918 Thyroid hormone synthesis
    107500068
   04928 Parathyroid hormone synthesis, secretion and action
    107500068
   04916 Melanogenesis
    107500068
   04924 Renin secretion
    107500068
   04925 Aldosterone synthesis and secretion
    107500068
   04927 Cortisol synthesis and secretion
    107500068
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107500068
   04270 Vascular smooth muscle contraction
    107500068
  09154 Digestive system
   04970 Salivary secretion
    107500068
   04971 Gastric acid secretion
    107500068
   04972 Pancreatic secretion
    107500068
   04976 Bile secretion
    107500068
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107500068
   04961 Endocrine and other factor-regulated calcium reabsorption
    107500068
  09156 Nervous system
   04724 Glutamatergic synapse
    107500068
   04728 Dopaminergic synapse
    107500068
   04726 Serotonergic synapse
    107500068
   04730 Long-term depression
    107500068
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107500068
  09159 Environmental adaptation
   04713 Circadian entrainment
    107500068
   04714 Thermogenesis
    107500068
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107500068
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107500068
  09165 Substance dependence
   05030 Cocaine addiction
    107500068
   05031 Amphetamine addiction
    107500068
   05032 Morphine addiction
    107500068
   05034 Alcoholism
    107500068
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    107500068
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107500068
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107500068
   05165 Human papillomavirus infection
    107500068
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107500068
   05142 Chagas disease
    107500068
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107500068
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107500068
   04031 GTP-binding proteins [BR:ray04031]
    107500068
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107500068
  Exosomal proteins of other body fluids (saliva and urine)
   107500068
  Exosomal proteins of colorectal cancer cells
   107500068
  Exosomal proteins of bladder cancer cells
   107500068
GTP-binding proteins [BR:ray04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    107500068
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 107500068
NCBI-ProteinID: XP_015980382
LinkDB
Position
Unknown
AA seq 228 aa
MDRRSRAPQWRRARHHHHDLCPPIGRRAATALLWLSCSIALLRALATSNGRAQPRRSFLN
AHHRSAAQVFPQPPESDPELEEAEPEPALPECLEFEDAFDYQSETESEIETDFDTEPGTA
PTTEAETEPEDERGPAVPKHSSAGQSLSERLRALGLRSPDASPRRAQPAAREPQRPRERE
VPRNENPRNPEKPKEKQQQRRCKPKKPARRDPSPESPARRGPIPIRRH
NT seq 687 nt   +upstreamnt  +downstreamnt
atggatcgcaggtcgcgggctccgcagtggcgccgagctcgccaccatcaccacgacctg
tgcccacccatcggccgccgggcagccaccgcgctcctctggctctcctgctccatcgcg
ctcctccgcgccctggccacctccaacggccgcgcccagccgcgccggagcttccttaac
gcccaccaccgctccgccgcgcaggtgttcccccagccccccgagtctgaccccgagctg
gaggaggctgagcccgagccggccctcccggagtgcctagagttcgaggacgccttcgac
taccagtccgagaccgagtctgagatcgagaccgacttcgacaccgagcccgggaccgcc
cccaccaccgaggccgagaccgagcccgaggacgagcgcggccccgcggtgcccaagcac
agcagcgccggccagtccctcagcgagcgcctgcgcgctctggggctgcggagccccgac
gcctcccccaggcgcgcgcagcccgccgcccgggagccccagcgccccagagaacgcgag
gtgccccggaacgagaatccaaggaaccccgagaagccgaaggagaagcagcagcagcgc
cgctgcaagcccaagaagcccgcgcgccgcgacccctccccggagtcccccgccagaagg
ggacccatccccatccggcgccactga

DBGET integrated database retrieval system