KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500115
Entry
107500115         CDS       T06036                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2 isoform X1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00250  Alanine, aspartate and glutamate metabolism
ray00410  beta-Alanine metabolism
ray00430  Taurine and hypotaurine metabolism
ray00650  Butanoate metabolism
ray01100  Metabolic pathways
ray04727  GABAergic synapse
ray04940  Type I diabetes mellitus
Module
ray_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107500115 (GAD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107500115 (GAD2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107500115 (GAD2)
   00430 Taurine and hypotaurine metabolism
    107500115 (GAD2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107500115 (GAD2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107500115 (GAD2)
Enzymes [BR:ray01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107500115 (GAD2)
SSDB
Motif
Pfam: Pyridoxal_deC COG7
Other DBs
NCBI-GeneID: 107500115
NCBI-ProteinID: XP_015980477
LinkDB
Position
Unknown
AA seq 307 aa
MASPGSGFWSFGSEDGSGDPENPGTARAWCQVAQKFTGGIGNKLCALLYGDAEKPAESGG
SEPPRATSRKAACACNQKPCSCPKADINYAFLHATDLLPACEGERPTLAFLQDVMDILLQ
YVVKSFDRSTKVIDFHYPNELLQEYNWELTDQPQNLEEILMHCQTTLKYAIKTGHPRYFN
QLSTGLDMVGLAADWLTSTANTNMFTYEIAPVFVLLEYVTLKKMREIIGWPGGAGDGIFS
PGGAISNMYAMLIARFKMFPEVKEKGMAAVPRLIAFTSEHSHFSLKKGAAALGIGTDSVI
LIKCDER
NT seq 924 nt   +upstreamnt  +downstreamnt
atggcctctcccggctccggcttttggtccttcggatcagaagatggttctggggatccc
gagaaccccggcacagcgagagcctggtgtcaggtggcccagaagttcaccggcggcatc
ggaaacaagctgtgcgctctgctctacggagacgccgagaagcccgcggagagcggcggg
agcgagcccccgcgggccacgtcccggaaggccgcctgtgcctgcaaccagaagccgtgc
agctgccccaaagcagatatcaactatgcatttctacacgcaacagacctgctgcccgcc
tgtgaaggagaaaggcccaccttggcatttctgcaggatgttatggatattttgcttcag
tatgtggtgaaaagtttcgatagatcaaccaaagtgattgatttccattaccctaatgag
cttcttcaagagtataattgggaattgacagaccaaccacaaaatttggaggaaattttg
atgcattgccaaacaactctaaaatatgcaattaaaacaggacaccccagatatttcaat
caactctccactgggctggatatggtgggattagcggcagactggctaacatcgacagca
aacactaacatgttcacctatgaaattgctccagtatttgtgcttttggaatatgtcacg
ctaaagaaaatgagagaaatcattggctggcctgggggtgctggcgatgggatattttct
cctggtggcgccatatccaacatgtacgccatgctgattgcgcgctttaagatgttccca
gaagtcaaggagaaaggaatggccgccgttccccggctcattgccttcacgtctgagcat
agtcatttttctctcaagaagggagctgcagccttgggcattggaacagacagcgtgatt
ctgattaaatgtgacgagaggtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503334
Entry
107503334         CDS       T06036                                 

Definition
(RefSeq) glutamate decarboxylase 2-like
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00250  Alanine, aspartate and glutamate metabolism
ray00410  beta-Alanine metabolism
ray00430  Taurine and hypotaurine metabolism
ray00650  Butanoate metabolism
ray01100  Metabolic pathways
ray04727  GABAergic synapse
ray04940  Type I diabetes mellitus
Module
ray_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107503334
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107503334
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107503334
   00430 Taurine and hypotaurine metabolism
    107503334
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107503334
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107503334
Enzymes [BR:ray01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107503334
SSDB
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Other DBs
NCBI-GeneID: 107503334
NCBI-ProteinID: XP_015986953
LinkDB
Position
Unknown
AA seq 339 aa
TYQKLQSCIIEEGNAEPKSCLNQSLQSTVYGWTFTLTCPLVKDNKANYSKQTYNVFIFSF
RGKMIPSDLERRIIEAKQKGFVPFLVSATAGTTVYGAFDPLLAVADICKKYKIWMHVDAA
WGGGLLMSRKHKWKLSGVERANSVTWNPHKMMGVPLQCSALLVREEGLMQSCNQMHASYL
FQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGATGFEAHIDKCLELAEYLYNIIK
NREGYEMVFDGKPQHTNVCFWYVPPSLRVLEDNEERMSRLSKVAPVIKARMMEYGTTMVS
YQPLGDKVNFFRMVISNPAATHQDIDFLIEEIERLGQDL
NT seq 1020 nt   +upstreamnt  +downstreamnt
acttaccagaaactgcagtcctgcatcattgaggaaggaaacgcagaaccaaagagttgt
ttaaaccaatcattacaatcaacggtttatggttggacttttaccctcacgtgtccactt
gtcaaagacaacaaagcaaattattcaaagcaaacctataatgtgtttattttttctttc
aggggaaaaatgattccatctgatcttgaaagaaggatcatcgaagccaagcaaaaagga
tttgttcctttccttgtgagtgcaacagctggaaccaccgtgtatggagcattcgatccc
ctcttagctgtcgctgatatctgcaaaaagtataagatctggatgcacgtggatgcagct
tggggtggaggattgctgatgtcccggaaacacaagtggaaactgagcggcgtggagagg
gccaactctgtgacatggaatccacacaagatgatgggtgtccctttgcagtgctctgct
ctcctggttagagaagagggactgatgcagagttgcaaccagatgcacgcctcctacctc
ttccagcaagataaacactatgacttgtcctatgacactggggacaaggctttacagtgc
ggacgccacgttgatgtttttaagttatggctgatgtggagagcaaagggggctacgggg
tttgaagcacatattgacaagtgtttggagctggcagagtatttatacaatatcataaaa
aaccgagaaggatatgaaatggtgttcgatggaaagcctcagcatacaaatgtctgcttc
tggtatgtccctccgagtttgcgtgtcctggaagacaacgaagagagaatgagtcgcctc
tcaaaggtggctccagtgatcaaagccagaatgatggagtatgggaccacaatggtcagc
taccagcccctgggagacaaggtcaatttcttccgcatggtcatctcgaatcctgcagca
actcaccaagacattgacttcctgattgaagaaatagaacgccttggacaagatttataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521061
Entry
107521061         CDS       T06036                                 

Gene name
GAD1
Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00250  Alanine, aspartate and glutamate metabolism
ray00410  beta-Alanine metabolism
ray00430  Taurine and hypotaurine metabolism
ray00650  Butanoate metabolism
ray01100  Metabolic pathways
ray04727  GABAergic synapse
ray04940  Type I diabetes mellitus
Module
ray_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    107521061 (GAD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107521061 (GAD1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    107521061 (GAD1)
   00430 Taurine and hypotaurine metabolism
    107521061 (GAD1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    107521061 (GAD1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107521061 (GAD1)
Enzymes [BR:ray01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     107521061 (GAD1)
SSDB
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 SepSecS DegT_DnrJ_EryC1 OKR_DC_1
Other DBs
NCBI-GeneID: 107521061
NCBI-ProteinID: XP_016020936
LinkDB
Position
Unknown
AA seq 594 aa
MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEK
SRLVSAFKERQSSKNLISCENSDRDGHFRRTETDFSNLFAQDLLPAKNGEEQTVQFLLEV
VDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGV
RTGHPRFFNQLSTGLDIIGLAGEWLTSTANTNMFTYEIAPVFVLMEQITLKKMREIIGWS
NKDGDGIFSPGGAISNMYSIMAARYKYFPEVKTKGMAAVPKLVLFTSEHSHYSIKKAGAA
LGFGTDNVILIKCSERGKIIPADLEAKILEAKQKGYVPLYVNATAGTTVYGAFDPIQEIA
DICEKYNLWLHVDAAWGGGLLMSRKHRHKLNGIERANSVTWNPHKMMGVLLQCSAILVKE
KGILQGCNQMCAGYLFQPDKQYDVSYDTGDKAIQCGRHVDIFKFWLMWKAKGTVGFENQV
NKCLELADYLYTKIKNREEFEMVFNGEPEHTNVCFWYIPQSLRGVPDSPERREKLHRVAP
KIKALMMESGTTMVGYQPQGDKANFFRMVISNPAATQSDIDFLIEEIERLGQDL
NT seq 1785 nt   +upstreamnt  +downstreamnt
atggcgtcttcgaccccttcttcgtctgcaacctcctcgaacgcgggagcggatcccaat
actaccaacctgcgccccacaacgtatgacacctggtgtggcgtggcccatggatgcacc
agaaaactggggctcaagatctgcggctttttgcaaaggaccaacagcctggaagagaag
agccggctcgtaagcgccttcaaggaaaggcagtcctccaagaacctgatttcctgtgaa
aacagtgacagggatggccacttccggcgcacggagaccgacttctctaacttgtttgct
caagatctgcttccagctaagaacggggaggagcaaactgtgcagttcctcctggaggtg
gtggacatacttctcaactatgtccgcaagacgttcgatcgctccaccaaggtgctggac
ttccatcacccacaccagctgctggaaggcatggagggcttcaacttggagctctccgac
caccccgagtccctggagcagatcctggttgactgcagagacaccctgaagtatggggtc
cgcacaggtcatcctcgatttttcaaccagctttccactggactggatatcattggttta
gctggagaatggctaacatcaactgccaataccaacatgtttacatatgaaattgctccg
gtgtttgtcctcatggagcaaataacacttaagaagatgagagagataattggatggtca
aataaagatggtgatgggatattttctcctgggggagccatatccaacatgtacagcatc
atggctgctcgctacaagtacttcccggaagttaagacaaagggcatggcggctgtgccc
aaactggttctcttcacctcagaacatagtcactattccataaagaaggctggggctgca
cttgggtttggaaccgacaatgtgattttgataaagtgcagtgaaagagggaagatcatt
cctgctgatttagaggcaaaaattcttgaagccaaacaaaagggatatgttcctctttat
gtcaatgcaactgctggcacaactgtttatggagcctttgatccgatacaggagattgca
gatatatgtgagaaatataacctctggctgcatgtcgatgctgcctggggtggtgggctg
ctcatgtcccgaaagcaccggcataaactcaatggcatagaaagagccaactcagtcacc
tggaaccctcacaagatgatgggcgtgctgttgcagtgctctgccattctcgtcaaggaa
aaggggatactccaaggatgcaaccagatgtgtgcaggatacctcttccagccagacaag
caatatgatgtctcctatgacacaggggacaaggcaattcagtgtggccgccatgtggac
attttcaagttctggctgatgtggaaagcaaagggcacagtgggatttgaaaatcaggtc
aacaaatgcttggaactggctgattacctctataccaagattaaaaacagagaagaattt
gagatggttttcaatggtgagcctgagcatacaaacgtctgtttctggtatattccacaa
agcctcaggggagtgccggatagccctgagcgccgggaaaaactacacagggtggctcca
aaaatcaaagccctcatgatggagtctggcacaaccatggtcggctaccagcctcagggg
gataaggccaacttcttccggatggtcatctcgaacccagccgctacccagtctgacatc
gacttcctcattgaggagatagaaagattgggccaggatctataa

DBGET integrated database retrieval system