KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500164
Entry
107500164         CDS       T06036                                 

Gene name
DLL1
Definition
(RefSeq) delta-like protein 1 isoform X1
  KO
K06051  delta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04330  Notch signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray05200  Pathways in cancer
ray05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107500164 (DLL1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107500164 (DLL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107500164 (DLL1)
  09162 Cancer: specific types
   05224 Breast cancer
    107500164 (DLL1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107500164 (DLL1)
SSDB
Motif
Pfam: EGF hEGF MNNL DSL EGF_2 EGF_CA EGF_3 cEGF
Other DBs
NCBI-GeneID: 107500164
NCBI-ProteinID: XP_015980573
LinkDB
Position
Unknown
AA seq 715 aa
MGRRCALALAVVSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPDGAGADPAFSNPIRFPLGFTWPGTF
SLIIEALHTDSPDDLATENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYYGEGCSVFCRPRDDAFGHFTCRERGEKVCNPGWRGQYCTEAICLPGCDEQHGFCDKP
GECKCRVGWQGRYCDQCIRYPGCLHGTCQQPWQCTCQEGWGGLFCNQDLNYCTHHKPCRN
GATCTNTGQGSYTCSCRPGFAGANCEAETDECAGKPCRNGGSCTDLENSYSCSCPPGFYG
RVCELSAMVCADGPCFNGGRCLDNPEGGYTCHCPTGFSGFNCEKKVDACSSSPCANGAQC
VDLGDAYLCRCPAGFSGQHCDDNVDDCASSPCTHGGTCRDGVNTFSCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHQRDRRYLCECARGYGGPNCQFLLPELPPGPVLVEGRAGPLPWA
AVCAGVVLVLVLLLGCAAAIVCVRLRLQKARPPSDSGRGETETMNNLANCQREKDLSVSV
VAAPQLKNTNEKAGLQAGHGAEKSSLKARCPRLDRNLAQELTGDAAGRDPHSKRDAEGQP
QGSAGEGKGAPTLRGREASERKRPDSVYSTSKDTKYQSVYVISEDKDECVIATEV
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgggccgccggtgcgccctggccctcgccgtggtctcggcgctgctgtgccaggtctgg
agctcgggcgtgttcgagctgaagctgcaggagttcgtcaacaagaaggggctgctgggg
aaccgcaactgctgccgcggcggcgcggggccgccgccgtgcgcctgcaggaccttcttc
cgcgtgtgcctcaagcactaccaggcgagcgtgtccccggagccgccctgcacctacggc
agcgccgtcacgccggtgctgggcgtcgactccttcagcctgcccgacggcgcgggcgcc
gaccccgccttcagcaaccccatccgcttcccgctgggcttcacctggccgggcaccttc
tctctgatcattgaggctctgcacacagattctcccgacgacctcgcaacagaaaacccg
gaaaggctcatcagccgcctggccacgcagaggcacctgacggtgggtgaggagtggtcc
caggacctgcacagtagcggccgcacggacctcaagtattcctaccgcttcgtgtgcgac
gagcactactacggggagggctgctccgtcttctgccgcccacgcgacgacgccttcggc
cacttcacgtgcagggagaggggagagaaggtctgcaaccccggctggagaggccagtac
tgcactgaagcaatctgtttgccaggatgcgacgagcagcatgggttttgtgacaagcca
ggggagtgcaagtgcagagtgggctggcagggccggtactgtgaccagtgcatccgctac
ccgggctgtctgcacggcacctgccagcagccgtggcagtgcacctgccaggagggctgg
gggggccttttctgcaaccaggacctgaactactgcacacaccacaagccctgcagaaac
ggggccacgtgcaccaacacggggcagggcagctacacatgctcctgccggcccgggttc
gcgggcgccaactgcgaggcggagacggacgagtgcgccggcaagccctgcaggaacggc
ggcagctgcacggacctggagaacagctactcctgcagctgcccccctggcttctatggc
agggtctgcgagctgagtgccatggtgtgcgctgacggcccatgcttcaacggcgggcga
tgcttggacaaccctgaggggggctacacctgccactgccccacgggcttctctggcttc
aactgtgagaagaaggtggacgcctgcagctcctcgccctgcgccaacggcgcgcagtgt
gtggacctgggcgacgcgtacttgtgccgctgcccggccggcttctctgggcagcactgt
gacgacaatgtggacgactgtgcctcctccccatgcacccacggtggcacctgccgggac
ggcgtgaacaccttctcctgcacctgcccgcccgggtacaccggcaggaactgcagtgca
cccgtcagcaggtgcgagcacgcgccctgccacaacggggccacctgccaccagagggac
cgccgctacctgtgtgagtgcgcccgcggctatggcggccccaactgccagttcctgctg
cccgagctgcccccggggcccgtgctggtggagggccgggccgggccgctgccctgggcc
gccgtctgcgcgggcgtggtcctcgtcctcgtgctgctgctgggctgtgccgctgccatc
gtctgcgtgcggctgaggctccagaaggcccggcccccctctgactctggccgcggggag
acagagaccatgaataacctggccaactgccagcgcgagaaggacctctcagtcagcgtg
gtcgcagccccgcagctgaagaacaccaatgagaaagcgggcctccaggcgggccacggc
gccgagaagagcagcctcaaggcccgctgcccccgcctggaccgcaacttggcgcaggag
ctcacgggcgacgccgccggcagggacccccacagcaagcgtgacgccgagggccagcct
cagggctctgcgggggaggggaagggcgccccgacactcaggggtagagaagcatctgag
agaaaacggccggactctgtgtattccacttcaaaagacacaaagtaccagtcggtatac
gtcatatcggaggacaaggatgagtgcgtcatagcgacggaggtgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514489
Entry
107514489         CDS       T06036                                 

Gene name
DLL4
Definition
(RefSeq) delta-like protein 4
  KO
K06051  delta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04330  Notch signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray05200  Pathways in cancer
ray05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107514489 (DLL4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107514489 (DLL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107514489 (DLL4)
  09162 Cancer: specific types
   05224 Breast cancer
    107514489 (DLL4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107514489 (DLL4)
SSDB
Motif
Pfam: EGF DSL hEGF MNNL EGF_2 EGF_3 DUF4381 Laminin_EGF
Other DBs
NCBI-GeneID: 107514489
NCBI-ProteinID: XP_016007737
LinkDB
Position
Unknown
AA seq 682 aa
MAAASRSASGWALLLLVAFWQQRAAGSGVFQLQLREFANERGVLASGRPCEPGCRTFFRV
CLMHFQAVFSPGPCTFGSVSTPVLGTNSFAVGDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEAMPPNALISKITIQGSLAVGQNWLLDEQTGPLPTRLSYSYRVICGDNY
YGDSCSRLCKKRNDHFGHYVCQPNGSLSCLPGWTGEYCDQPICLSGCHEQNGYCSKPAEC
ICRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGAT
CSNSGQRSYTCTCRPGYTGVDCELKLSKCDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHC
EHSTLSCADSPCFNGGSCRERNQGASYACECPPSFTGSNCEKKVDRCTNNPCANGGQCLN
RGPNHICRCRPGFTGTHCELHISDCARSPCAHGGTCHDLENGLVCTCPAGFSGRRCEVRT
PSDACASGPCYNGATCYTGPSPDNFVCNCPYGFVGSHCEFPVSFPWVAVSLGVGLVVVLV
LLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGLDKS
NCGKRQNHTLDYNLAPGPLGRGTMSGKYSHSDKSLGEKAPLRLHSEKPECRISAICSARD
SMYQSVCLISEERNECVIATEV
NT seq 2049 nt   +upstreamnt  +downstreamnt
atggcagccgcgtcccgtagcgcctctggttgggcgctactgttactggtggcattttgg
cagcagcgcgcggccggctccggagtcttccagctgcagctgcgggagtttgccaacgag
cgcggcgtactggccagcgggcggccgtgcgaacccggctgccggaccttcttccgcgtc
tgcctcatgcacttccaggcggtcttctctcccggtccctgcaccttcggcagcgtctcc
acacctgtgttgggcaccaactccttcgccgtcggggacgacagtagcggcggaggacgc
aaccctctccaattgcccttcaattttacctggccgggtaccttctcactcatcatcgaa
gcttggcacgcgccgggagacgacctgcggccagaggccatgccaccgaatgccctcatc
agcaagatcaccattcagggctctctagctgtgggccagaactggttactggatgagcag
accggccctctcccaacacggctgagctactcttaccgggtcatctgcggtgacaactac
tatggggatagctgctcacgcctgtgcaagaagcgcaatgaccacttcggccactacgtg
tgccagccaaatggcagcctgtcttgcctgcccggctggacaggggagtactgcgaccag
ccaatctgtctttctggctgtcatgaacagaatggctactgcagcaagccagcggagtgc
atctgccgcccaggctggcagggtcgcctatgcaatgaatgcatcccccacaatggctgt
cgtcatggcacctgcagcaccccctggcaatgtacctgtgatgagggctggggaggccta
ttctgtgaccaagatctcaactattgcacccaccactccccatgcaagaatggggcaacg
tgctccaacagtgggcagcggagctatacctgcacctgtcgcccaggctacactggcgtg
gactgtgagctaaagctcagcaagtgtgacagcaacccctgtcgcaatggaggcagctgt
aaggaccaagaggacggctaccattgcctgtgtcccccaggttactatggcctgcattgt
gaacacagcaccttgagctgtgctgactccccttgcttcaatgggggttcctgccgggag
cgcaaccagggtgccagctatgcctgcgaatgcccccccagcttcactggctccaactgc
gagaagaaagtggacaggtgtaccaacaatccatgtgccaatgggggccagtgcctgaac
agaggcccaaaccacatatgccgctgccgtcctggattcacaggcacccactgtgaactt
catatcagcgactgtgcccgcagcccttgtgcccatggcggcacctgccatgacctggag
aatgggctcgtgtgcacctgccctgctggcttctctggccggcgctgtgaagtgcggaca
ccaagtgatgcctgtgcctcgggaccctgctacaatggggccacctgctacactggcccc
tctccagacaacttcgtctgcaactgcccctatggttttgtgggcagccactgcgagttc
cctgtgagcttcccctgggtggctgtctccctgggtgtggggctggtggtggtgctggtg
ttgctgggcatggtggcagtggctgtgcggcagctgcggcttcggcggccagacgacggc
agcagggaggccatgaacaacttgtcagacttccagaaggacaacctgatccctgctgcc
cagctcaagaacacaaaccagaagaaggagctggaagtggactgtggcctggacaagtcc
aactgtggcaaacggcagaaccacacattggactataatctggccccaggacccttgggg
cgggggaccatgtccgggaagtattcccacagtgacaagagcttaggggagaaggcaccg
ctgcggttacacagtgaaaaaccagagtgtcggatatcagcgatatgctccgccagggac
tccatgtaccagtctgtgtgtttgatatcagaggagaggaatgaatgtgtcattgccaca
gaggtataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521802
Entry
107521802         CDS       T06036                                 

Gene name
DLL3
Definition
(RefSeq) delta-like protein 3
  KO
K06051  delta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04330  Notch signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray05200  Pathways in cancer
ray05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    107521802 (DLL3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    107521802 (DLL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107521802 (DLL3)
  09162 Cancer: specific types
   05224 Breast cancer
    107521802 (DLL3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107521802 (DLL3)
SSDB
Motif
Pfam: EGF hEGF EGF_2 EGF_CA DSL
Other DBs
NCBI-GeneID: 107521802
NCBI-ProteinID: XP_016022303
LinkDB
Position
Unknown
AA seq 592 aa
MVAPWMLQLLSPTVILALFFLPQARPAGVFELQIHSFGPGPSLGTPRSPCSAAGPCRLFF
RLCLKPGVSEGGAESPCALGAALSARGPVYQEQSGVPAPDLPLPDGLMRVPFREAWPGTF
SLIIETWKEELGEQIGGPTWSLLARVAGRRRLAAGGPWAREVQRPGAWELRFSYRARCEP
PAVGAACARLCHSRSAPSPCGPGLRPCTPVEEECKASLVCRAGCSTEHGFCEQPDECRCL
EGWTGPLCTVPVSTSSCLSPRGPSSATTRCLVPGPGPCDGNPCANGGSCSETLGSFECTC
PRGFYGLRCEVSGVTCADGPCFNGGLCVGGTDPDSAYICHCPPGFQGSNCEKRVDRCSLQ
PCRNGGLCLDLGHALRCRCRTGFAGPRCEHDLDDCASRACANGGTCLEGGGGARRCSCAL
GFGGRDCRERADPCAARPCAHGGRCYAHFSGLICACAPGYMGARCEFPVRPDGADEGAGA
LPAALPGPRQGDPQRFLLPPALGLLVAAGVAGAALLMVHVRRRGPGQDTGSRLLAGTPEP
SVHALPDALNNLRTQEGSEDGLSPPANWSRPEDGDSPEIYVISASSIYAQEA
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggtcgccccgtggatgctccaactcctgtccccaacggtgattctggcactctttttc
cttccccaggcacgaccggctggcgtcttcgagctgcagatccactctttcgggccggga
cccagcctggggaccccgcggtccccctgcagcgctgcgggcccctgccgactcttcttt
aggctctgcctgaagccgggggtctctgaggggggcgccgagtccccgtgcgccctaggc
gcagcactgagtgcgcgtggaccagtctaccaggagcagtccggggtgccggcacctgac
ctgccactgcctgatggcctcatgcgcgtgcccttccgggaagcctggccgggcacattc
tctctcattatcgaaacctggaaagaggagttaggagagcagatcggagggcccacctgg
agcctgctggcgcgtgtggcaggccggcgccgcctggcggcagggggcccctgggcccgg
gaagtgcagcgcccgggtgcctgggagctgcgcttctcctaccgcgcgcgctgcgagccc
cctgccgtgggggccgcgtgcgcgcgcctctgccactcgcgcagcgccccctcgccgtgc
gggccaggactgcgcccctgcacccccgtggaagaggagtgcaaggcctcgttggtatgt
cgagctggctgcagcacagagcacggcttctgtgagcagcctgatgaatgtcggtgtctg
gagggctggaccgggcccctctgcacggttcctgtctccaccagcagctgtctcagcccc
aggggcccatcctctgccaccactagatgccttgtacctggtcctgggccctgtgacggg
aacccgtgtgccaatgggggcagctgtagtgagacactggggtcctttgaatgcacctgc
ccccgtgggttctatgggttgcggtgtgaggtgagcggggtgacatgtgcagatggacct
tgcttcaatggcggcttgtgtgtgggaggcacagaccctgattctgcctacatctgccac
tgcccgcccggtttccaaggctccaactgtgagaagagggtggaccggtgcagtctgcag
ccatgccggaatggcgggctctgcctggacctgggccacgccctgcgctgccgctgccgc
accggcttcgctgggccgcgctgcgaacacgacctggacgactgcgccagccgcgcctgc
gccaacggcggcacgtgcctggagggcggtggcggggcgcgccgctgctcctgcgcgctg
ggcttcggcggccgcgactgtcgcgagcgtgcggatccgtgcgccgcgcggccctgcgcc
cacggcggacgctgctacgcccacttctccggcctcatttgcgcctgcgcgcccggctac
atgggcgcgcgctgtgagttcccagtccgccccgacggcgcggacgaaggcgcaggcgca
ctgcccgcagcactgccgggcccgaggcagggggacccgcagcgcttccttttgccaccg
gctttgggactgttggtggccgcgggtgtggccggcgcagcgctcttgatggtccatgtg
cgacgccgtggccctggccaggatactgggtcccgcttgctggcagggaccccggagcca
tcggtccacgcactccctgatgcactcaacaatttgaggactcaggaaggttctgaggat
ggcctgagcccacctgcaaattggagtcgtcctgaagatggagactctcccgagatttac
gtcatatcagcttcttcgatctatgctcaggaggcctga

DBGET integrated database retrieval system