KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500168
Entry
107500168         CDS       T06036                                 

Gene name
RPS6KA3
Definition
(RefSeq) ribosomal protein S6 kinase alpha-3 isoform X1
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04114  Oocyte meiosis
ray04150  mTOR signaling pathway
ray04714  Thermogenesis
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04931  Insulin resistance
ray05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107500168 (RPS6KA3)
   04150 mTOR signaling pathway
    107500168 (RPS6KA3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107500168 (RPS6KA3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107500168 (RPS6KA3)
  09156 Nervous system
   04720 Long-term potentiation
    107500168 (RPS6KA3)
   04722 Neurotrophin signaling pathway
    107500168 (RPS6KA3)
  09159 Environmental adaptation
   04714 Thermogenesis
    107500168 (RPS6KA3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107500168 (RPS6KA3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107500168 (RPS6KA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107500168 (RPS6KA3)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107500168 (RPS6KA3)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107500168 (RPS6KA3)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107500168 (RPS6KA3)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107500168 (RPS6KA3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal Pkinase_C APH YrbL-PhoP_reg tRNA-synt_1f
Other DBs
NCBI-GeneID: 107500168
NCBI-ProteinID: XP_015980579
LinkDB
Position
Unknown
AA seq 754 aa
MPLAQLADPWQKMAVESPSDSAEVFFFPPSEDLRRGQNGQQIMDEPMGEEEINPQTEEGS
IKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKAT
LKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFT
EEDVKFYLAELALALDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAY
SFCGTVEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLG
MPQFLSPEAQSLLRMLFKRNPANRLGAGPDGVEEIKRHLFFSTIDWNKLYRREIHPPFKP
ATGRPEDTFYFDPEFTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHS
IVQQLHRNSIQFTDGYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEI
LLRYGQHPNIITLKDVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAVLFTITKT
VEYLHAQGVVHRDLKPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVA
PEVLKRQGYDAACDIWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWN
SVSDTAKDLVSKMLHVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAAT
YSALNRNQSPVLEPVGRSTLAQRRGIKKITSTAL
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgccgctggcgcagctggcggacccgtggcagaagatggctgtggagagcccatccgac
agtgcggaggtttttttctttcccccaagtgaagatctgaggagaggacagaatggacag
caaattatggatgaacctatgggagaggaagagattaatccacaaactgaagaaggcagt
atcaaagaaattgcaatcacacatcatgtaaaggaaggacatgaaaaggcagatccttcc
cagtttgaacttttaaaagtattagggcagggatcatttggaaaggttttcttagtcaaa
aaaatctcaggctctgatgctagacagctttatgccatgaaagtgttgaagaaggccaca
ctgaaagttcgagaccgtgttcggacaaaaatggagcgtgatatcttggtagaagttaat
catccttttattgtcaagttgcattatgcttttcaaactgaagggaagttgtatcttatt
ttggattttctcaggggaggagatttgtttacacgcttatccaaagaggtgatgttcaca
gaagaagatgtcaaattctacttggctgaacttgcacttgctttagaccatctacatagc
ctgggaataatctatagagacttaaaaccagaaaacatacttcttgatgaagaaggtcac
atcaaattaacagattttggcctaagtaaagagtctattgaccatgaaaagaaggcatat
tctttttgtggaactgtggaatatatggctccagaagtagttaatcgtcgaggtcatact
caaagtgcggactggtggtcttttggtgtattgatgtttgagatgctcactgggacactg
cctttccaaggaaaagatcgaaaagaaacaatgactatgatccttaaagccaaacttggg
atgccacagtttttgagtcctgaagcccagagtcttttacgaatgcttttcaaacgaaat
cctgcaaacagattaggcgcaggaccagatggagttgaagaaattaaaagacacttattt
ttctcaactatagactggaataaactgtacagaagagaaattcatccaccttttaaacct
gcaactggcaggcctgaagatacattctattttgaccctgagtttactgcaaaaactccc
aaagattcacctggcattccacctagtgctaatgcacatcagctttttcgggggtttagt
tttgttgctattacctcagatgatgaaagccaagctatgcagacagttggtgtgcattca
attgttcagcagttgcacaggaacagtattcagtttactgatggatatgaagtaaaagaa
gatattggagtcggctcctactctgtttgcaagagatgtatacataaagccacaaacatg
gagtttgcagtaaagattattgataaaagcaagagagacccaacagaagaaattgaaatt
cttcttcgttatggacagcatccaaacattattactctaaaggacgtatatgatgatgga
aaatatgtgtatgtagtgacagaactcatgaaagggggtgaattactggataaaattctt
agacagaaatttttctctgaacgagaggccagcgctgtcctgtttactataaccaaaact
gttgaatatcttcacgcacaaggggtggttcacagagacttgaaacctagcaacattctt
tacgtggatgaatctggcaatccagaatctattcgaatttgtgattttggctttgccaaa
cagctaagagcagaaaatggtcttctcatgactccttgttatactgcaaattttgttgca
ccagaggttttaaaacgacaaggctatgatgctgcttgtgatatatggagtcttggtgtc
cttctctatacaatgcttactggttacactccatttgcaaatggccctgatgatacacca
gaggaaatattggcacgcataggcagcggcaaattctcactcagcggcggttactggaat
tctgtttcagacacagcaaaggacctggtgtcgaagatgcttcatgtagaccctcatcag
agactgactgctgcccttgtgctcagacacccgtggatagtccactgggaccaactgcca
caataccaactgaacagacaggacgcaccgcatctggtcaagggtgccatggcagctacg
tattctgctttaaatcgtaatcagtcaccagttttggaaccagtaggtcgttctactctt
gctcagcggagaggtattaaaaaaatcacctccacagccctgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501695
Entry
107501695         CDS       T06036                                 

Gene name
RPS6KA2
Definition
(RefSeq) ribosomal protein S6 kinase alpha-2 isoform X1
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04114  Oocyte meiosis
ray04150  mTOR signaling pathway
ray04714  Thermogenesis
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04931  Insulin resistance
ray05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107501695 (RPS6KA2)
   04150 mTOR signaling pathway
    107501695 (RPS6KA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107501695 (RPS6KA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107501695 (RPS6KA2)
  09156 Nervous system
   04720 Long-term potentiation
    107501695 (RPS6KA2)
   04722 Neurotrophin signaling pathway
    107501695 (RPS6KA2)
  09159 Environmental adaptation
   04714 Thermogenesis
    107501695 (RPS6KA2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107501695 (RPS6KA2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107501695 (RPS6KA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107501695 (RPS6KA2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107501695 (RPS6KA2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107501695 (RPS6KA2)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107501695 (RPS6KA2)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107501695 (RPS6KA2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal Pkinase_C APH YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 107501695
NCBI-ProteinID: XP_015983595
LinkDB
Position
Unknown
AA seq 743 aa
MWRLMFRNRKAPGSQGPRDPAAPETGPAAPGGLRTHSGPLPAGGEEGVVKEIDISHHVKE
GFEKADPSQFELLKVLGQGSYGKVFLVRKVKGSDARQLYAMKVLKKATLKVRDRVRSKME
RDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELA
LALDHLHGLGVIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKRAYSFCGTIEYMAPE
VVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMALVLKAKLGMPQFLSPEAQSL
LRALFKRNPCNRLGAGSDGVEEIKRHPFFATVDWNKLYRKEIKPPFKPAVGRPEDTFHFD
PEFTARTPTDSPGVPPSANAHHLFRGFSFVASSLAQEASQQETPTPVHPVVQQLHGNNVH
FTDGYEVKEDLGVGSYSVCKRCVHKATDAEYAVKIIDKSKRDPSEEIEILLRYGQHPNII
TLKDVYDDGRLVYLVTELMRGGELLDRILQHRCFSEREASQVLCTVARTVDYLHSQGVVH
RDLKPSNILYMDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDA
ACDIWSLGILLYTMLAGFTPFANGPDDTPEEILARIGSGEYALSGGNWDSISDAAKDVVS
KMLHVDPHQRLTAVQVLKHPWIVNRESLSQDQLSRQDVRLVKGAMAATYFALNRTPRAPR
LEPVLSSSLAQRRGMKRLTSTRL
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgtggaggttgatgtttagaaacagaaaagccccgggctcgcagggcccgcgggacccg
gccgcaccagagacgggaccggccgcgcctggagggctgaggacacactcgggcccattg
cctgcgggcggcgaagaaggcgttgtcaaggagattgacatcagccaccatgtgaaagaa
gggttcgagaaggcagacccctcccagtttgaactgctgaaggttttaggacaaggatcc
tacggaaaggtgttcctggtgcggaaggtcaaggggtcggacgcacgacagctctacgca
atgaaagtcctgaagaaagcgaccttgaaagttcgggaccgagtcagatccaagatggag
agagacattttggcagaagtgaaccaccccttcatcgtaaagcttcattatgccttccag
acggaggggaagctctacctgatcctggacttcctgcggggaggggacctcttcaccagg
ctctccaaggaggtgatgttcacggaggaggacgtcaagttctacctggctgagctggcc
ttggccctggaccacctgcacggcctgggggtcatctacagagacctgaaacctgagaac
atcctcctggacgaagagggacacatcaagatcacagatttcgggctgagcaaggaggcc
atcgaccacgacaagagggcctactcgttctgcggcaccatcgagtacatggcgcccgag
gtggtgaaccggcggggacacacgcagagcgcggactggtggtccttcggcgtgctcatg
ttcgagatgctgacggggtccttgccattccaggggaaggacaggaaggagaccatggcc
ctcgtcctcaaggccaagctgggcatgcctcagttcctcagccccgaggcccagagcctg
ctgcgtgcgctcttcaagcggaacccctgcaaccgtctgggcgccggcagcgacggcgtg
gaggagatcaagcggcaccctttctttgccaccgtggactggaacaaactgtaccggaag
gagatcaagccgcccttcaagcccgcggtgggcaggccggaggacaccttccacttcgac
cccgagttcacagcccggacgcccacagactcccctggtgtcccccccagcgccaacgct
caccacctgttccgagggttcagcttcgtggcctccagcctggcccaggaggcctcgcag
caggagacgcccacccccgtgcaccccgtcgtgcagcagctccacggcaacaacgtccac
ttcaccgacggctacgaggtcaaggaggacctcggcgtgggctcctactccgtgtgcaag
cgctgcgtgcacaaagccaccgacgcggagtacgccgtgaagatcatcgataagagcaaa
cgcgacccctcggaagagatcgagatcctcctgcggtacggccagcacccgaacatcatc
acgctcaaggacgtctacgacgacgggaggctcgtgtacctggtgacggagctgatgcgc
ggcggggagctgctggaccgcatcctgcagcaccgctgcttctccgagcgggaggccagc
caggtgctgtgcaccgtcgccaggaccgtggactacctgcactcccagggggtcgtgcat
cgggacctgaagccgagcaacatactgtacatggacgagtccgggaaccccgagtccatc
cgcatctgtgacttcgggtttgccaagcagctgcgagccgagaatgggctgctcatgaca
ccctgctacaccgcgaacttcgtggcccccgaggtcctgaagcggcaaggctatgacgcg
gcgtgtgacatctggagtttggggatcctgctctacaccatgctggcggggttcaccccg
tttgcaaacgggcccgacgacacccccgaggagatcctggcgcgcatcggcagcggggag
tacgccctctccggcgggaactgggactccatctcggacgcggcaaaggacgtggtatcc
aaaatgctccacgtggacccccaccagcgcctgacggccgtgcaggtcctgaaacacccg
tggattgtgaacagagagtccctgtcccaagaccagctcagcaggcaggacgtccggctg
gtgaagggcgcgatggccgccacctacttcgctctgaacagaaccccccgggcgccgcgg
ctggagccggtgctgtcgtccagcctggcccagcgcaggggcatgaagcgactcacgtcc
acgaggctgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503561
Entry
107503561         CDS       T06036                                 

Gene name
RPS6KA1
Definition
(RefSeq) ribosomal protein S6 kinase alpha-1 isoform X1
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04114  Oocyte meiosis
ray04150  mTOR signaling pathway
ray04714  Thermogenesis
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04931  Insulin resistance
ray05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107503561 (RPS6KA1)
   04150 mTOR signaling pathway
    107503561 (RPS6KA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107503561 (RPS6KA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107503561 (RPS6KA1)
  09156 Nervous system
   04720 Long-term potentiation
    107503561 (RPS6KA1)
   04722 Neurotrophin signaling pathway
    107503561 (RPS6KA1)
  09159 Environmental adaptation
   04714 Thermogenesis
    107503561 (RPS6KA1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107503561 (RPS6KA1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107503561 (RPS6KA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107503561 (RPS6KA1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107503561 (RPS6KA1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107503561 (RPS6KA1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107503561 (RPS6KA1)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107503561 (RPS6KA1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo Pkinase_fungal Pkinase_C APH YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 107503561
NCBI-ProteinID: XP_015987548
LinkDB
Position
Unknown
AA seq 744 aa
MEQDPKPPRLRLLDLLPWLPRKQRPRISQTSLPAPGPGSGPRRDLDEGVLKEISITHHVK
AGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKATLKVRDRVRTKM
ERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAEL
ALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAP
EVVNRQGHTHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQS
LLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYF
DTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRATQAPLHSVVQQLHGKN
LVFSDGYVVKETIGVGSYSVCKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPN
IITLKDVYDDGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLYTISKTVEYLHSQGV
VHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGY
DEGCDIWSLGVLLYTMLAGYTPFANGPSDTPEEILTRIGSGKFTLSGGNWSTVSETAKDL
VSKMLHVDPHQRLTAKQVLQHPWITQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPT
PQLKPIESSILAQRRVRKLPSTTL
NT seq 2235 nt   +upstreamnt  +downstreamnt
atggagcaggatcccaagccgccccgtctgcggctcttggacctgctcccctggctgccc
aggaagcagcggcccaggatcagccagacctctctgcctgcccctggtcctggctctggc
cccaggcgggacttggatgagggcgtcctcaaggagatctccatcacgcaccatgtcaag
gctggctctgagaaggctgacccatcccattttgagctgctcaaggttctgggccaggga
tcctttggcaaagtcttcctggtgcggaaggtcacccgacctgacagtgggcacctgtat
gccatgaaggtactaaagaaggcaactctgaaagtgcgtgaccgcgttcggaccaagatg
gaaagagacatcctggctgatgtaaaccacccgtttgtggtaaagctgcactatgccttc
cagaccgagggcaagctctatcttattctggacttcctgcgtggcggggacctcttcaca
cggctctctaaagaggtcatgttcacagaggaggacgtgaagttttacctggctgagctg
gccttgggcctggaccacctgcacagcttgggcattatttacagggacctcaagcctgag
aacatccttctggatgaggagggccacatcaagctcactgactttggcctgagcaaggag
gccattgaccacgagaagaaggcctattctttctgtgggacagtggagtacatggccccc
gaggtcgtcaaccgccagggccacacccacagtgcagattggtggtcctatggggtcttg
atgtttgagatgttgacgggctccttgcccttccaggggaaggaccggaaggagacaatg
acactgattctgaaggcgaagctaggcatgccccagtttctgagcacagaagcccagagc
ctcctgcgggccctgttcaagcggaatcctgccaaccggctcggctccggccctgatggg
gcagaggaaatcaagcgacatgtcttctactccaccatcgactggaataagctgtaccgc
cgtgagatcaagccacccttcaagccggccgtggcgcaacccgatgacaccttctacttt
gacactgagttcacatcccgtacacccaaagactccccaggcatcccccccagtgctggt
gcccatcagctgttccgtggcttcagctttgtggccactggcctgatggaggatgacggc
aagcctcgggctacgcaggcgccgctgcactcggtagtacagcaactccatgggaagaac
ctggttttcagtgacggctacgtggtaaaggagacgattggtgtgggctcctactctgtg
tgcaagcggtgtgtccacaaggccaccaacatggaatatgctgtcaaggtcatcgacaag
agcaagcgggatccttcagaagagattgagattcttctgcggtacgggcagcaccccaac
atcatcactctgaaggatgtgtatgatgatggcaaacacgtgtacctggtgacagagctg
atgcggggcggggagctgctggacaagatcctacggcagaaattcttctcggagcgggag
gccagcttcgtcctctacaccatcagcaagaccgtggagtatctgcactcccagggggtc
gtgcatagggacctcaagcccagcaacatcctgtatgtggacgagtctgggaaccctgag
tgcctgcgcatctgtgactttggcttcgccaagcagctacgggctgagaatgggctactc
atgacaccctgttacaccgccaactttgtggcgcctgaggtgctcaagcgccaaggctac
gacgaaggctgtgatatctggagcctgggcgttctgctgtacaccatgctggcgggatat
accccatttgccaatggacctagtgacaccccagaggaaatcctgacccggattggcagt
ggaaagttcaccctcagtgggggaaactggagcacggtttcagagacagccaaggacctg
gtgtccaagatgctgcacgtggacccccaccagcgcctcacagctaagcaggtcctgcaa
cacccatggatcacccagaaagacaagcttccccagagccagctgtcccaccaggaccta
caacttgtgaagggagccatggcagctacgtactctgcactcaacagctccaagcccacc
cctcagctgaagcccattgagtcatctatcctggctcagcggcgagtgaggaagctgccg
tccaccaccttgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519754
Entry
107519754         CDS       T06036                                 

Gene name
RPS6KA6
Definition
(RefSeq) ribosomal protein S6 kinase alpha-6 isoform X1
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04114  Oocyte meiosis
ray04150  mTOR signaling pathway
ray04714  Thermogenesis
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04931  Insulin resistance
ray05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107519754 (RPS6KA6)
   04150 mTOR signaling pathway
    107519754 (RPS6KA6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107519754 (RPS6KA6)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107519754 (RPS6KA6)
  09156 Nervous system
   04720 Long-term potentiation
    107519754 (RPS6KA6)
   04722 Neurotrophin signaling pathway
    107519754 (RPS6KA6)
  09159 Environmental adaptation
   04714 Thermogenesis
    107519754 (RPS6KA6)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107519754 (RPS6KA6)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107519754 (RPS6KA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107519754 (RPS6KA6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107519754 (RPS6KA6)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107519754 (RPS6KA6)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   107519754 (RPS6KA6)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     107519754 (RPS6KA6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo Pkinase_C YrbL-PhoP_reg APH
Other DBs
NCBI-GeneID: 107519754
NCBI-ProteinID: XP_016018219
LinkDB
Position
Unknown
AA seq 745 aa
MLLPIAPQDESWDQEMEVFGGVACSGEMNGLKMVDEPMEEGKADSCQGEGVVKEIPITHH
VKEGYEKADPAQFELLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLKKASLKVRDRVRT
KMERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLA
ELALALDHLHQLGIVYRDLKPENILLDEIGHIKLTDFGLSKESVDQEKKAYSFCGTVEYM
APEVVNRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSAEA
QSLLRMLFKRNPANRLGSEGVEEIKRHLFFANIDWNKLYKREVQPPFKPASGKPDDTFCF
DPEFTAKTPKDSPGLPASANTHQLFKGFSFVATSIAEEYKITPITGSNVLPIIQINGNAA
QFGEAYELKEDIGVGSYSVCKRCIHTATNMELAVKIIDKSKRDPSEEIEILMRYGQHPNI
ITLKDVYDDGSYVYLVTDLMKGGELLDRILKQKCFSEREASDVLFVITKTVDYLHCQGVV
HRDLKPSNILYMDESTSADCIRICDFGFAKQLRGENGLLLTPCYTANFVAPEVLMQQGYD
AACDIWSLGALFYTMLAGYTPFANGPDDTPEEILLRIGNGKFSLSGGNWENISDGAKDLL
SHMLHMDPRQRYTTEQVLTHSWITQRDQLPNYQPNRNDTSCVFKGTVVATYSIMTHKTFQ
PVLEPVAASSLAQRRSMKKRTSTGL
NT seq 2238 nt   +upstreamnt  +downstreamnt
atgctgctacctatcgctcctcaggacgagtcctgggaccaagaaatggaggtgttcggc
ggcgtcgcttgcagcggcgagatgaatggtcttaaaatggttgatgagccaatggaagaa
gggaaagcagattcttgccaaggcgaaggagttgttaaagaaattcctattacccatcac
gttaaggaaggatatgagaaagcagaccctgcacagtttgagttgctcaaggttcttggt
cagggatcctttggaaaggtttttcttgttagaaagaagaccggccctgatgctggccaa
ctttatgcaatgaaggtgttaaaaaaagcttctttaaaagttcgagacagagttcggaca
aagatggagagggatatattagtagaagtaaatcacccatttattgtcaaattgcactat
gcctttcagactgaagggaagctgtatttaattttggattttctcaggggaggagacgtg
ttcacaagattatccaaagaggttctatttacagaggaagatgtgaaattctaccttgca
gaactagcccttgctttggatcatctgcaccaattaggaattgtgtatagagacttgaag
ccagaaaacattttgcttgatgaaataggacatatcaagttaacagattttggactcagc
aaggaatcagtagatcaagaaaagaaggcctactcattttgtggtacagtggaatatatg
gctcccgaagtggtaaataggagaggtcattctcagagtgctgattggtggtcatatggt
gtacttatgtttgaaatgcttactggtacactaccatttcaaggtaaagacagaaatgag
accatgaatatgatattaaaagcaaaacttggaatgcctcagtttcttagtgctgaagca
caaagtcttctaaggatgttattcaaaaggaatccagcaaatagattgggttcagaagga
gttgaggaaatcaaaagacatcttttttttgcaaatattgactggaacaaattatataaa
agagaagttcaacctcctttcaaacctgcttctggaaaaccagatgatactttttgtttt
gatcctgaatttactgcaaaaacacctaaagattctcctggtttgccagccagtgctaat
actcatcagctcttcaaaggattcagctttgttgcaacttctattgcagaagaatataaa
atcactcctatcacaggttcaaatgtattaccaattatccagataaatggaaatgctgca
caatttggtgaagcatatgaattgaaagaggacattggcgttggctcctattctgtttgc
aagcgatgcatacatacagctaccaacatggaattagcagtgaagatcattgacaaaagt
aagagagacccctcagaagaaattgaaattttgatgcgttatggacaacaccccaacatt
atcactctaaaggatgtttatgatgatggtagctatgtttatcttgttacggatttgatg
aaaggaggagagctacttgaccgtattctcaaacaaaagtgtttctcagaacgggaagct
agtgatgtactgtttgtaataactaagacagttgactatcttcattgtcaaggagttgtt
catcgtgatcttaaacctagtaatattttatacatggatgaatcaaccagtgcagactgc
attagaatctgtgattttggatttgcaaaacaacttcgaggcgaaaatggacttctctta
actccatgctacactgcaaactttgtagcacctgaggttcttatgcaacagggctatgat
gctgcttgtgatatttggagcctaggagcccttttttacacaatgttggctggctatact
ccatttgctaatggccccgatgatactcctgaagagatactgctgcgtataggcaacgga
aagttctctttgagtggtggaaactgggaaaatatttcagatggagcaaaggatttgctt
tcccatatgctacatatggatccacgtcagcggtacacaacagaacaagtattaacacac
tcatggataacccagagagaccagttaccaaattatcagccaaatagaaatgacacatca
tgtgtctttaagggaacagtggttgccacatattcaatcatgactcacaagacctttcaa
ccagtcctagagcctgttgctgcttcaagcttagctcagcgacggagtatgaaaaagcga
acatctactggcctgtaa

DBGET integrated database retrieval system