KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500388
Entry
107500388         CDS       T06036                                 

Gene name
MYH14
Definition
(RefSeq) LOW QUALITY PROTEIN: myosin-14
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04270  Vascular smooth muscle contraction
ray04530  Tight junction
ray04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107500388 (MYH14)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107500388 (MYH14)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107500388 (MYH14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107500388 (MYH14)
   04147 Exosome [BR:ray04147]
    107500388 (MYH14)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107500388 (MYH14)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   107500388 (MYH14)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ ADIP AAA_22
Other DBs
NCBI-GeneID: 107500388
NCBI-ProteinID: XP_015981010
LinkDB
Position
Unknown
AA seq 2059 aa
MSPGRGGPAFLPAKEGGAARGAPSQEGRSARRGCCQSSKLVLRHPHLQPDCSETMAAVTM
TAPGRKVPPRPGPVPEAAQPFLFAPRGPGVGVGPGGPATSPQVEWTARRLVWVPSELHGF
EAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEASVLHNL
RERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHVYAVTEGAYRSM
LQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRKEPGVPASASTISYGELERQ
LLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKD
ECSFHIFYQLLGGAGQQLRADLLLEPSSHYRFLTNGPASSPGQERELFQETLESLRVLGF
THEEITSMLRMVSAVLQFGNIVLKKERSTDQASMPDNTAAQKLCRLLGLGVTDFSRALLT
PRIKVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRSPRQGASFLGIL
DIAGFEIFQLNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQREGIPWTFLDFGLDLQPC
IDLIERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGGHPKFQRPRHLRDQADFSVL
HYAGKVDYKANEWLMKNMDPLNDSVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGP
PGGRPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKRAGKLEPKLVLDQLR
CNGVLEGIRICRQGFPNRILFQEFRQRYELLTPNAIPKGFMDGKQACEKMIQALELDPNL
YRVGQSKIFFRAGVLAQLEEERDLKVTDIIVSFQAAARGYLARRAFQKRQQQQSALRVMQ
RNCAAYLKLRHWQWWRLFTKVKPLLQVTRQDEVLQARAQELQKVQELQQQSAREVGELQG
RLAQLEEERARLAEQLRAEAELCSEAEETRGRLAARKQELELVVAELEARVGEEEECSRQ
LQSEKKRLQQHIQELETHLEAEEGARQKLQLEKVTTEAKLKKFEEDLLLLEDQNTKLSKE
RRLLEERLSEFSSQAAEEEEKIKSLNKLRLKYEATIADMEDRLRKEEKGRQELEKLRRRL
DGESSELQEQMAEQQQRVEELRAQLGRKEEELQAALTRAEEEGGARAQLLKSLREAQAGL
AEAQEDLEAERLARAKAEKQRRDLGEELEALRGELEDTLDSTNAQQELRSKREQEVTELK
KALEEETRVHEVTVQELRQRHGQALGELAEQLEQARRGKGVWEKTRLALETEVSELRAEL
SNLQSTRQEGEQRRRRLESQLQEAQGRAGDGERARAELAEKLQRAQAELENVSGALSEAE
SRAIRLSKEMSSTEVQLHDAQELLQEETRAKLALGSRVRALEAEAAGLREQLEEEAAARE
RAGRELQTAQVQLSEWRRRQEEEAGALEAGEEARRRAAREAEALAQRLTEKTEAVERLER
GRRRLQQELDDVTVDLEQQRQLVGSLEKKQRKFDQLLAEEKAAVLRAVEERERAEAEGRE
REARALALARALEEEQEARGDLERQTRALRAELEALLSSKDDVGKSVHELERARRVAEQA
ASDLRTQVTELEDELTAAEDAKLRLEVTVQALKAQHERDLQGRDEAGEERRRQLAKQLRD
AEVERDEERKQRALAVAARQKLEADLEDLKAQAAAAGQGKEEAVKQLRKMQAQMKELWRE
VEESRSSREEIFAQNRESDKRLKGLEAEVLRLQEELAASDRARRQAQQERDEMADEVANG
SLSKAALLDEKRQLEGRLGQMEEELEEEQSNAELLGDRYRKLLLQVESLTTELSAERSFS
AKAESGRQQLERQVQELRGRLAEEDAGARARQKMTIAALESKLAQAEEQLEQESRERILS
GKLVRRAEKRLKEVVLQVEEERRVSDQLRDQLEKGNLRVKQLKRQLEEAEEEASRAQAGR
RRLQRELEDVTESAESMNREVTTLRNRLRRGPLTFTTRTVRQVFRLEEGVASDEEAEEAE
PGSGPQAPEPNGPPEAQPQ
NT seq 6180 nt   +upstreamnt  +downstreamnt
atgagccctggcagaggcggtcctgccttcctgccggctaaagagggtggggctgccaga
ggcgctcccagccaagagggcaggtccgcgcgtcggggctgttgtcagtcctcaaaactg
gtcctcaggcatcctcacctccagcctgactgcagcgagaccatggcggcagtgaccatg
accgcgcctgggcggaaggtgcccccaaggccaggcccggtgccggaggcagcacaaccg
ttcctgttcgcgccgcggggtccgggtgtgggcgtcgggcctgggggcccggccacctcc
ccgcaggtggagtggacggcgcgccgcctggtgtgggtgccctccgagctgcacgggttc
gaggctgcggcgctgcgggacgagggcgaggaggaggccgaggtggagctggccgagagc
gggcggcggctgcggctgccgcgggaccagatccagcgcatgaacccgcccaagttcagc
aaggccgaggacatggccgaactgacttgcctcaacgaggcctcggtgctgcacaacctc
cgggaacggtactactccggcctcatctacacatactccggccttttctgtgtggtcatc
aacccatacaagcagcttcccatctacacggaggcgatcgtggagatgtaccggggcaag
aagcgccacgaggtgccacctcacgtgtatgcggtgaccgagggggcctacagaagcatg
ctgcaggatcgtgaggatcagtccattctctgcactggcgagtctggggctgggaagaca
gagaacaccaagaaggtcattcagtacctcgcccatgtggcatcgtcgccaaagggtagg
aaggagccgggcgtcccggcctccgccagcaccatatcttatggcgagctggagcggcag
ctccttcaggccaaccccatcctggaggccttcggcaatgctaagactgtgaagaatgac
aactcctcccgatttggcaagttcatacgcatcaatttcgacgtcgctgggtacatcgtg
ggggccaacatcgagacctacctgctggagaagtcgcgggccatccgccaggccaaggac
gagtgcagcttccacatcttctaccagctgctgggtggcgcgggccagcagctcagggct
gacctcctgctggagccgagttcccactaccgcttcctgaccaatggcccggcgtcctcc
cccggccaggagcgcgagctcttccaggagacactggagtccctgcgggtcctgggcttc
acacacgaggagatcacctctatgctgcggatggtctcagccgttctccagttcggtaac
attgtcttgaagaaggaacgcagcacggatcaagcctccatgccggacaacacagccgcc
cagaagctctgccgcctcctgggactgggggtgacggatttctcccgcgccctgctcacc
ccgcgcatcaaagttggccgagactacgtgcagaaagcacagaccaaggagcaggctgac
ttcgcgttggaggccctggccaaggccacctacgagcgcctcttccgctggctggtgctg
cgcctcaaccgagctctagaccgcagcccccgccagggcgcctccttcctgggcatcctg
gacatcgccggcttcgagatcttccagctgaactccttcgagcagctgtgcatcaactac
accaatgagaagctgcagcagctgttcaaccacaccatgttcatcctggagcaggaggag
taccagcgcgagggcatcccctggaccttcctggacttcggcctcgacctgcagccctgc
atcgacctcatcgagcggccggccaacccccctgggctcctggccctgctggacgaggag
tgctggttcccgaaggcaacggacaagtccttcgtagagaaggtggcccaggagcagggc
ggccaccccaagttccagcggccgaggcacctgcgggaccaggccgactttagcgtcctg
cactatgctggcaaggtggactataaggccaacgagtggctgatgaaaaacatggacccg
ctgaacgacagcgtcgcggccctgctgcaccagagcacggaccggctgaccgcggagatc
tggaaggatgtggagggcatcgtggggctggagcaggtgagcagccttggggacggcccc
cccggcggccgccctcgccggggaatgttccggacagtgggacagctctacaaggagtcc
ttgagccgcctcatggccacgctcagcaacacaaatcccagcttcgtccgctgtattgtc
cccaaccacgagaagcgggcggggaagctggagcccaagctggtgctggaccagctgcgc
tgtaatggtgtcctggagggcatccgcatctgtcgccagggcttccccaaccgcatcctc
ttccaggagttccggcaacggtatgagctcctgacacccaatgcgatccccaagggcttc
atggatgggaagcaggcctgcgagaaaatgatccaggccctggaactggaccccaacctc
taccgtgtgggacagagcaagatcttcttccgggcaggggtcctggcccagctggaggag
gagcgggacctcaaggtcacagacatcattgtgtccttccaggcggctgcccggggatac
ctggctcgcagggccttccagaagcggcagcagcagcagagtgcgctgagggtgatgcag
aggaactgtgcggcgtacctcaagctgaggcactggcagtggtggcggctcttcaccaag
gtgaagccactactgcaggtgacacggcaggacgaggtgctgcaggcgcgggcccaggag
ctgcagaaagtgcaggagctacagcagcagagtgcccgcgaggtgggcgagctccagggc
cgcctggcacagctggaagaggagcgtgcccgcctggcagagcagctgcgggcagaggcg
gagctgtgctctgaggccgaggagacccgggggcggctggcggcccgcaagcaggagctg
gagctggtggtggcggagctggaggcccgcgtgggcgaggaggaggagtgcagccggcag
ctgcagagtgagaagaagcggctgcagcagcacatccaggagctggagacccacctcgag
gccgaggagggggcccggcagaagctgcagctggagaaggtgacgacggaggcaaagctg
aagaagttcgaggaagacttgttgcttctagaggatcagaacaccaagctgagtaaggag
cggaggctgctggaggaacgcctgtccgagttctcatcccaggcggcagaggaggaggaa
aagatcaaaagcctcaataaactgcgactgaaatacgaggccaccattgcagacatggag
gaccgcctgcggaaggaggagaagggccgccaggagctggagaagctgaggcggcggctg
gacggcgagagctccgagctgcaggagcagatggccgaacagcagcagcgcgtggaggag
ctgcgcgcccagctgggccgcaaggaggaggagctgcaggccgccctgaccagggccgag
gaggagggcggagcccgggcccagctgctcaagtccctgagggaggcacaggcggggctg
gccgaggcccaggaggacctggaggctgagcgcttggccagggccaaggcggagaagcag
cgcagggacctgggcgaggagctggaggcgctgcggggtgagctggaggacacgctggac
tccaccaacgcccagcaggagctccggtccaagagggaacaggaggtaacagagttgaag
aaggctctggaggaagagacgcgcgtccacgaggtgacagtgcaggagctgaggcagcgc
cacggccaagcactgggagagctggcggagcagctggagcaggcccggaggggcaaaggc
gtgtgggagaagacccggctagctctggagactgaggtgtctgagctacgggcggagcta
agtaacctgcagagcacccgtcaggagggcgagcagcggaggcgccgtctggagtcacag
ctgcaggaggcgcagggccgggcgggtgacggggagcgggcacgggcagagcttgccgag
aagctgcagcgagcccaggctgaacttgagaacgtgtctggggcactgagtgaggctgag
tccagagccatcaggctgagcaaagagatgagcagcacggaggtccagctgcatgacgcc
caggagctgctgcaggaggagaccagggcgaagctggccttggggtcccgggtgcgagcc
ttggaggcggaggcggcaggactgcgggagcagctggaggaggaagcagctgccagggag
cgggcgggccgtgagctgcagactgcccaggtccagctctcagagtggcggcggcgccag
gaagaagaggccggggccctggaggcaggggaagaggcccggcgccgggcggcccgtgag
gccgaggccctggcccagcgcctgaccgagaagacggaggcggtggagcggctggagagg
ggccggcggcggctgcagcaggagctggacgatgtcaccgtggacctggagcaacagcgg
cagcttgtgggctccttggagaagaagcagcgcaaattcgaccagctcctggcagaggag
aaggcagcggtgctgcgggcggtggaggagcgtgagcgcgcggaggccgagggccgcgag
cgggaggcccgggcactggctctggcgcgggcgctggaggaggagcaggaagcgcgcgga
gacctggagcgccagacccgggccctgcgggcggagctggaggccctgctgagcagcaag
gacgacgtgggcaagagcgtacatgagctggagcgagcccgccgggtggcagaacaagcg
gccagtgacctccggacacaggtgacagagctggaggacgagctgacggcggccgaggat
gccaagctgcgcctggaagtgaccgtgcaggccctcaaggcccagcacgagcgcgacctg
cagggccgggacgaggccggtgaggagcggcggcggcagctagccaaacagctgcgggat
gcagaggtggagcgggacgaggaacgcaagcagcgcgccctggccgtggctgcccgccag
aagctggaggcggacctggaggacctgaaggcacaggccgcagctgcagggcaaggcaag
gaagaggcggtgaagcagcttcgcaagatgcaggcccagatgaaggagctgtggcgggag
gtggaagagtcgcgcagctcacgggaggagatctttgcccagaaccgggagagcgacaag
cgccttaaggggctggaggcggaggtgctgcggctgcaagaggaactggccgcctcagac
cgtgccaggaggcaggcccagcaggaacgggatgagatggcggacgaggtggccaacggc
agccttagcaaggctgcccttctggacgagaagcgccagctggaggggcgtctagggcaa
atggaagaggagctggaggaagagcagagcaacgcagagttacttggcgaccgctaccgg
aagctgctcctgcaggtggaatcgctgaccacagagttgtcagctgagcgcagtttctca
gccaaggcagagagcggccggcagcagctggagcgacaggtccaggagctccggggccgc
ctagccgaggaggatgctggggcccgggcccgccagaagatgaccattgctgctttggag
tctaagctggcccaggccgaggagcagctggaacaggagagcagggaacgcatcctctcc
ggcaagctggtgcgcagagctgagaagcggctgaaggaggtggtgctccaggtggaggag
gagcggagggtgtccgaccagctcagggaccagctggagaagggtaacctgcgtgtgaag
cagctgaagcggcagctggaggaggcggaagaggaggcgtccagggcccaggcaggtcgc
cggaggctgcagcgcgagctggaggatgtcacagagtctgccgagtccatgaaccgggag
gtgaccacgctgaggaaccggctccgacgtgggcccctcaccttcaccacccgcaccgtt
cgccaggtcttccggctggaggagggtgtagcgtcagacgaggaggccgaggaggcagag
ccggggtctgggccacaggcccctgagcccaacgggccccccgaagcccagccccagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515660
Entry
107515660         CDS       T06036                                 

Gene name
MYH10
Definition
(RefSeq) myosin-10 isoform X1
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04270  Vascular smooth muscle contraction
ray04530  Tight junction
ray04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107515660 (MYH10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107515660 (MYH10)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107515660 (MYH10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107515660 (MYH10)
   04147 Exosome [BR:ray04147]
    107515660 (MYH10)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107515660 (MYH10)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   107515660 (MYH10)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N IQ ADIP CC2-LZ Crescentin AAA_22
Other DBs
NCBI-GeneID: 107515660
NCBI-ProteinID: XP_016010174
LinkDB
Position
Unknown
AA seq 2037 aa
MRLGSRRLGLGAGANEHHFRGNCSWILLSKMAQRSGLEDPERYLFVDRAVIYNPATQADW
TAKKLVWIPSERHGFEAASIKEERGDEVMVELAENGKKAMVNKDDIQKMNPPKFSKVEDM
AELTCLNEASVLHNLKDRYYSGLIYTYSGLFCVVINPYKNLPIYSENIIEMYRGKKRHEM
PPHIYAISESAYRCMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSHKGRKDHNI
PQESPKPVKHQGELERQLLQANPILESFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGAN
IETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLLLEGFNNYRFLSNGYIPIPGQ
QDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNISFKKERNTDQASMPENTVAQK
LCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFAVEALAKATYERLFRWLVHRI
NKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTNEKLQQLFNHTMFILEQEEYQ
REGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECWFPKATDKTFVEKLVQEQGSH
SKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNVATLLHQSSDRFVAELWK
DEIQNIQRASFYDSVSGLHEPPVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKE
SLTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRI
VFQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLE
EERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFT
KVKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAE
TELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQL
DEEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEE
EKAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQID
ELKIQLTKKEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEK
QKRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQ
RHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDA
QVQELHAKVSEGDRLRVELAEKANKLQNELDNVSTLLEEAEKKGIKFAKDAASLESQLQD
TQELLQEETRQKLNLSSRIRQLEEEKSSLQEQQEEEEEARKNLEKQVLALQSQLTDTKKK
IDDDLGTIESLEEAKKKLLKDVEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQ
RQIVSSLEKKQKKFDQLLAEEKNISARYAEERDRAEAEAREKETKALSLARALEEALEAK
EEFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATE
DAKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASK
KKMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEETRASRDEIFAQSKESE
KKLKSLEAEILQLQEELASSERARRHAEQERDELADEIANSASGKSALLDEKRRLEARIA
QLEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKA
KLQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVE
DERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSR
EVSTLKNRLRRGGPISFSSSRSGRRQLHIEGASLELSDDDTESKTSDVNETQPPQSE
NT seq 6114 nt   +upstreamnt  +downstreamnt
atgagattggggtcccggcggctaggactgggagcgggagccaatgaacatcatttcaga
ggcaattgctcttggatccttctgtctaaaatggcacagagaagtggacttgaagatcca
gagaggtatctctttgtggacagggctgtcatctacaaccctgccactcaggctgattgg
acggctaaaaagctagtgtggattccatcagaacgccatggttttgaggcagctagtatc
aaagaagaacggggagatgaagttatggtggagttggcagagaacggaaagaaagcaatg
gtcaacaaagatgatattcagaagatgaacccacctaagttttctaaggtggaggatatg
gcagaattgacgtgtttaaacgaagcttctgttttacataatctgaaggatcgttactat
tcaggacttatctatacttattcaggactcttctgtgtagtcataaatccttacaagaat
cttccaatttactcggagaatattattgaaatgtacagagggaaaaaacgtcatgagatg
ccgccacacatctatgctatatctgaatctgcttacagatgcatgcttcaagatcgtgag
gaccagtcaatactttgcacgggtgaatcaggtgctgggaagacagaaaatactaagaaa
gtcattcagtaccttgctcatgttgcttcttcacataaaggacgaaaggaccataatatt
cctcaggaatcacctaaaccagtgaaacaccagggggaacttgaacggcagcttttgcaa
gcaaatccaattctggaatcatttggaaatgcgaagactgtgaaaaatgataactcatct
cgttttggcaagtttattcggattaactttgatgtaactggctatattgttggggccaac
attgaaacataccttctggaaaaatctcgtgctgttcgtcaagcaaaagatgagcgtact
tttcatatcttttaccagttgttatctggagcaggagaacacctaaagtctgatttgctc
cttgaaggatttaataactacagatttctctccaatggctatattcccattccgggacag
caagacaaagataactttcaggagacaatggaagcgatgcatataatgggcttctctcat
gaagagattctgtcaatgcttaaagtagtatcttcagtgcttcagtttggaaatatttct
ttcaaaaaggagcgaaacactgatcaagcttctatgccggaaaatacagttgcacagaag
ctctgccatcttcttgggatgaatgtgatggagtttactcgggctatccttaccccgcgg
atcaaggttggccgagactacgtgcagaaagcccagaccaaagaacaagcagattttgca
gtagaagcattggcaaaagctacctatgagcggctctttcgttggctcgttcaccgtatc
aataaagctctggataggaccaaacgtcagggagcatctttcattggaatcctggatatt
gctggatttgaaatttttgagctaaactcctttgaacaactttgtatcaactacaccaat
gagaagctgcagcagctgttcaaccacacgatgttcatcctagagcaagaggagtaccag
cgcgaaggcatcgagtggaacttcatcgattttggattagacctgcagccatgcattgac
ctgatagagagacctgctaaccctcctggtgtcctggcccttttggatgaagagtgctgg
tttcctaaagccacggataaaacctttgttgaaaaactagttcaagagcaaggttcccac
tccaaatttcagaaacctcggcaactgaaagacaaagctgacttttgcattatacattat
gcagggaaggtggactataaggcagatgagtggctaatgaagaacatggaccctctgaat
gacaatgtggccacactcctgcaccagtcatcagatagatttgtggcagagctttggaag
gatgagattcagaatattcagagagcttctttctatgacagtgtttctggtcttcatgag
ccaccagtggatcgtattgtgggtctggatcaagttactggtatgactgagacagctttt
ggctctgcatataaaaccaaaaagggcatgtttcgtactgttggacagctctacaaagaa
tctctcaccaagctgatggctactctccgcaacaccaaccctaattttgttcgctgcatc
attccaaatcacgagaaacgggctggaaaactggatcctcatctagtgctggatcagctt
cgctgtaatggtgtcctggaagggatcagaatctgtcgccaggggttccccaaccggata
gttttccaggaattcagacagagatatgagatcctaactccaaatgctatccctaaaggt
tttatggatggtaaacaggcttgtgaacgaatgatacgggctttagaattggacccaaat
ttatacagaattggacagagcaagatatttttcagagctggagttttggcacacttagag
gaagaaagggatttaaaaattaccgatatcattatcttcttccaggctgtttgcagaggt
tacctagccagaaaggcctttgctaagaagcagcagcaactaagtgccttaaaggtcttg
cagcggaactgtgccgcgtatctgaaactacggcactggcagtggtggcgtgtcttcacg
aaggtgaagccactcctgcaagttactcgccaggaggaagaacttcaggccaaagatgaa
gagctgctgaaggtgaaggagaagcagacaaaagtggaaggagagcttgaggagatggag
aggaagcaccaacaacttttagaagagaagaatatccttgcagaacaactacaagcagag
actgagctctttgctgaagcagaagagatgagagcaagacttgctgctaaaaagcaggaa
ttagaagagattctacatgacttggagtctagggttgaagaagaagaagaaagaaaccaa
attctccaaaatgaaaagaaaaaaatgcaggcacatattcaggacctagaggagcagctg
gatgaggaagaaggggctcggcagaaactgcagctggagaaggtgacagcagaggctaaa
atcaagaagatggaagaggagattctgcttctcgaggaccaaaactccaaatttatcaaa
gaaaagaaactcatggaagatcgcattgctgaatgttcctctcagctggctgaagaggaa
gaaaaggcaaaaaacttggctaaaatcaggaataagcaagaagtgatgatctcagattta
gaagaacgcttaaagaaagaagagaagactcgtcaggaactggaaaaggccaaaaggaaa
ctggatggtgaaacaactgacctgcaggatcagattgctgagctgcaggcacagatcgac
gagctcaagattcagctcaccaagaaggaggaggagctgcagggcgctctggccaggggc
gacgatgaaacactccataagaacaatgcacttaaagtcgtgcgagagctgcaagcccaa
attgctgaacttcaagaagactttgaatctgagaaggcttcacggaacaaagcagaaaag
caaaaaagggacttgagtgaggagctggaagctctgaaaacagagttggaggacactctg
gacaccaccgcagctcagcaggaactacgtacaaaacgtgaacaagaagtggcagagctg
aagaaagctcttgaggaagaaactaagaaccatgaagctcaaatccaggacatgagacag
agacatgcaacagccctggaggagctctcggagcaactggaacaggctaaaaggttcaaa
gcaaatctagaaaagaacaagcagggcctggagacagacaacaaggaactggcgtgtgag
gtgaaggtgctgcagcaggtcaaggccgagtctgagcacaagaggaagaaacttgatgcc
caggtccaggagctccatgccaaagtctcagaaggagacagactcagggtggaactggcc
gagaaagcaaataaattacagaatgaattagataatgtctcaactcttctggaagaagca
gagaagaagggtattaaatttgctaaggacgcagctagtcttgagtctcaactacaggat
acacaggagcttcttcaggaggagacacgccagaagctgaacctgagcagtcggattcga
cagctagaagaggagaagagcagtcttcaggagcagcaggaggaggaggaggaggccagg
aagaacctggaaaaacaagtgctggccctgcagtcccagttgacggataccaagaagaaa
atagatgatgacctgggaacaatcgaaagtttggaagaagccaaaaagaaacttcttaaa
gacgtggaggccctgagccagcgcctggaggaaaaggctctggcctatgacaagctggag
aagaccaagaaccgcctgcagcaggagctcgatgacctgacagtggacctggaccaccag
cgccagatcgtctccagcttggagaagaagcagaagaagtttgatcagctcttagcagaa
gagaagaatatatctgctcgctatgctgaagagcgagaccgtgctgaagcagaggccaga
gagaaagaaaccaaagccttgtccctggccagggccctcgaggaggccctggaggccaag
gaggagtttgagaggcagaacaaacagctgcgggcagacatggaagacctgatgagctcc
aaggatgacgtggggaagaatgtccatgaacttgaaaaatccaaacgggccctagagcag
caggtggaagaaatgagaacccagctggaagagctagaagatgaacttcaggcaacagaa
gatgccaagcttcgcctggaggtcaacatgcaggccatgaaggcccagtttgagagagat
ttgcaaacccgagatgagcagaacgaagaaaagaagcggctactgattaagcaagtgcgg
gagctcgaggcagagctggaggatgagcgaaaacagcgggcacttgctgttgcttcaaag
aagaaaatggaaatagacctgaaggaccttgaagctcaaatcgaggctgcaaacaaagct
agggatgaagtcatcaagcagcttcgcaaacttcaggctcagatgaaggattaccagcgt
gaattagaagaaactcgtgcatcccgggatgagatttttgctcaatccaaagagagtgaa
aagaaattaaagagcctggaagccgaaatccttcaattgcaggaggaacttgcctcatcc
gagcgagcccgccgacatgccgagcaggagagagatgagctggctgatgagatcgccaac
agcgcctctggcaagtctgccctactggatgagaagcggcgtctggaggcacgaatcgca
cagctggaggaggagcttgaagaggaacagagcaatatggagctgctcaatgaccgcttt
cgcaagaccacgctacaggtggatacgctgaatgcagagctggcggcggagcgcagcgct
gcccagaagagcgacaatgcacgccagcagctggagcggcagaacaaggagctgaaggcc
aagctgcaggaactagagggtgctgtcaagtccaagttcaaggccaccatctctgcccta
gaagccaagattgggcaactggaggagcagcttgagcaagaagccaaggaacgagcagca
gccaacaaactggtccgacgtaccgagaagaagctgaaagaaatcttcatgcaggttgaa
gatgaacgtcgacatgcagatcagtataaagaacagatggagaaggccaatgccaggatg
aagcagcttaaacggcagctggaggaagcagaagaagaagctacgcgtgccaatgcatct
cggcgtaagctccagcgggaactggatgatgccactgaggccaatgagggcctgagccgt
gaggtcagcactctgaagaaccggctgaggcgcggtggcccaatcagcttctcttcaagc
cgatctggccggcgccagctgcacatcgaaggggcttccctagagctgtcagacgatgac
actgagagtaagaccagtgatgttaatgagacgcagccgccccagtcagagtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516819
Entry
107516819         CDS       T06036                                 

Gene name
MYH11
Definition
(RefSeq) myosin-11 isoform X1
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04270  Vascular smooth muscle contraction
ray04530  Tight junction
ray04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107516819 (MYH11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107516819 (MYH11)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107516819 (MYH11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107516819 (MYH11)
   04147 Exosome [BR:ray04147]
    107516819 (MYH11)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107516819 (MYH11)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   107516819 (MYH11)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Crescentin CC2-LZ IQ Filament ADIP AAA_22
Other DBs
NCBI-GeneID: 107516819
NCBI-ProteinID: XP_016012427
LinkDB
Position
Unknown
AA seq 1911 aa
MEQEDVHGGLGQCSLRWALARQGPVGRGPEHPSLSCSGSKLGFSIWQTYSGLFCVVINPY
KQLPIYSEKIVEMYKGKKRHEMPPHIYAIADTAYRSMLQDREDQSILCTGESGAGKTENT
KKVIQYLAVVASSHKGKKDTSITQGPSLAYGELEKQLLQANPILEAFGNAKTVKNDNSSR
FGKFIRINFDVTGYIVGANIETYLLEKSRAIRQARDERTFHIFYYLIAGAKDKMKNDLLL
EGFNNYTFLSNGFVPIPAAQDDEMFQETLEAMGIMGFNEEEQLSVLKVVSSVLQLGNIVF
KKERNTDQASMPDNTAAQKVCHLMGINVTDFTRSILTPRIKVGRDVVQKAQTKEQADFAI
EALAKATYERLFRWILSRVNKALDKTHRQGASFLGILDIAGFEIFEVNSFEQLCINYTNE
KLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIERPNNPPGVLALLDEECWF
PKATDKSFVEKLCSEQGNHPKFQKPKQLKDKTEFSIIHYAGKVDYNASAWLTKNMDPLND
NVISLLNASSDKFVADLWKDVDRIVGLDQMAKMTESSLPSASKTKKGMFRTVGQLYKEQL
GKLMTTLRNTTPNFVRCIIPNHEKRSGKLDAFLVLEQLRCNGVLEGIRICRQGFPNRIVF
QEFRQRYEILAANAIPKGFMDGKQACILMIKALELDPNLYRIGQSKIFFRTGVLAHLEEE
RDLKITDVIMAFQAMCRGYLARKAFAKRQQQLTAMKVIQRNCAAYLKLRNWQWWRLFTKV
KPLLQVTRQEEEMQAKEDELQKIKERQQKAEGELKELEQKHSQLAEEKNLLQEQLQAETE
LYAEAEEMRVRLAAKKQELEEILHEMEARLEEEEDRGQQLQAEKKKMAQQMLDLEEQLEE
EEAARQKLQLEKVTAEAKIKKLEDEILVMDDQNNKLSKERKLLEERISDLTTNLAEEEEK
AKNLTKLKNKHESMISELEVRLKKEEKSRQELEKLKRKLEGEASDFHEQIADLQAQIAEL
KMQLAKKEEELQAALARLDDEIAQKNNALKKIRELEGHISDLQEDLDSERAARNKAEKQK
RDLGEELEALKTELEDTLDSTATQQELRAKREQEVTVLKKALDEETRSHEAQVQEMRQKH
TQAVEELTEQLEQFKRAKANLDKNKQTLEKENADLAGELRGLSQAKQEVEHKKKKLEAQL
QELQSKCSDGERARAELSDKVHKLQNEVESVTGLLSEAEGKAIKLAKDVATLGSQLQDTQ
ELLQEETRQKLNVSTKLRQLEDERNSLQEQLDEEMEAKQNLERHISTLNVQLSDSKKKLQ
DFASTVEALEEGKKRSQKELEGLTQQYEEKAAAYDKLEKTKNRLQQELDDLVVDLDNQRQ
LVSNLEKKQKKFDQLLAEEKTISSKYADERDRAEAEAREKETKALSLARALEEALEAKEE
LERTNKMLKAEMEDLVSSKDDVGKNVHELEKSKRALETQMEEMKTQLEELEDELQATEDA
KLRLEVNMQALRGQFERDLQARDEQNEEKRRQLQRQLHEYETELEDERKQRALAAAAKKK
LEGDLKDLELQADSAVKGREEAIKQLRKLQAQMKDFQRELEDSRASRDEIFATAKENEKK
AKSLEADLMQLQEDLAAAERARKQADLEKEELAEELASTVSGRNTLQDEKRRLEARIAQL
EEELEEEQGNMEAMSDRVRKATQQAEQLSNELATERSAAQKNESARQQLERQNKELRSKL
QEMEGAVKSKFKSTIAALEAKVAQLEEQVEQEAREKQAAAKSLKQKDKKLKEALLQVEDE
RKAAEQYKEQAEKGNAKVKQLKRQLEEAEEESQRINANRRKLQRELDEATESNEAMGREV
TALKSKLRRGNETSFVPSRRSGGRRVIENADGSDEEMDARDADFNGTKASE
NT seq 5736 nt   +upstreamnt  +downstreamnt
atggagcaggaagatgtccacggtggcctgggtcagtgcagtctgcgatgggcattagca
cgtcagggtcccgtgggcaggggacccgagcacccctccctgtcatgttccggaagtaag
cttgggttctccatttggcagacgtactccggcctcttctgcgtggtgatcaatccctac
aagcaactgcccatctactcggagaagatcgtcgaaatgtacaagggcaagaagaggcac
gagatgccaccccacatctacgcgatcgcggacacagcctaccggagcatgctgcaagat
cgagaggaccagtcgattctgtgcacaggcgagtccggagccgggaaaacggagaacact
aagaaagtcatccagtacctggccgtggtggcctcctcccacaagggcaagaaggacacg
agcatcacgcaaggcccatctcttgcctacggcgagctggaaaagcagcttctacaagca
aacccgattctggaggcttttggcaacgccaaaactgtcaagaacgacaactcctcacga
ttcggcaagttcatccgcatcaatttcgatgtcaccggttacattgtgggagccaacatt
gagacatatctgctagaaaagtcacgggcgattcgccaagccagggacgagaggacgttc
cacatcttttactatctgattgccggagccaaggataagatgaaaaacgacctgcttttg
gagggcttcaacaactacacgttcttgtccaacggttttgtgcccatcccggctgcccag
gacgacgagatgttccaggagaccttggaggccatggggatcatgggcttcaatgaggag
gagcagctgtccgtcctgaaggtggtatcgtccgtcctgcagctgggcaacatcgttttc
aagaaggaaagaaatacggaccaggcgtccatgccggataacacagctgctcagaaagtt
tgtcacctcatgggaattaatgtgacggatttcacccgatccatcctgactccacgaatc
aaagtcgggcgggatgtggtacagaaagctcagacgaaagaacaggcagacttcgccata
gaggctctggccaaggccacatatgaacgcctcttccgctggatcctcagccgcgtgaac
aaagccctggacaagacccaccggcagggggcttcgttcctggggatcctggacatcgcg
gggtttgagatcttcgaggtgaactccttcgagcagctgtgcatcaactacaccaacgag
aagctgcagcagctcttcaaccacaccatgttcatcctggagcaggaggagtaccagcgc
gagggcatcgagtggaacttcatcgacttcgggctggacctgcagccctgcatcgagctc
atcgagcggccgaacaaccctccaggtgtgctggccctgctggacgaggagtgctggttc
cccaaggccacggacaagtccttcgtggagaagctgtgctcggagcagggcaaccacccc
aagtttcagaagcccaagcagctcaaggacaaaaccgagttctccatcatccactatgcc
gggaaggtggactacaacgccagcgcctggctgaccaagaacatggacccactgaacgac
aacgtgatttcgctcctcaacgcctcctcggacaagttcgtggccgacctgtggaaggac
gtggaccgcatcgtggggctggaccagatggccaagatgacggagagctcgctgcccagc
gcctccaagaccaagaagggcatgttccgcacggtggggcagctgtacaaggagcagctg
gggaagctgatgaccacgctgcgcaacaccacgcccaacttcgtgcgctgcatcatcccc
aaccacgagaagcggtctggcaagctggacgccttcctggtgctggagcagctgcggtgc
aatggggtgctggaaggcatccgcatctgccgccagggcttccccaacaggatcgtcttc
caggagttccgccaacgctacgagatcctggctgcgaacgccattcccaaaggcttcatg
gacgggaagcaggcctgcatcctcatgatcaaagccctggaactcgaccccaacttgtac
aggattgggcagagcaagatcttcttccgcactggggtcctggcccacctggaagaggag
agagacttgaagatcaccgatgtcatcatggctttccaggccatgtgtcgtggctacctg
gccagaaaggcctttgccaagaggcagcagcagctgacagccatgaaggtgattcagagg
aactgcgccgcctacctcaagctgcggaactggcagtggtggaggctcttcaccaaggtg
aagcccctgctgcaggtgacgcggcaggaggaggagatgcaggccaaggaggatgagctg
cagaagatcaaggagcggcagcagaaggcagagggggagctcaaggagctggagcagaag
cactcgcagctggccgaggagaagaacctgctgcaggagcagctgcaggcggagacagag
ctgtatgcagaggccgaggagatgcgggtccggctggcagccaagaagcaggagctggag
gagatcctgcacgagatggaagcccgcctggaggaagaggaagaccggggccagcagctg
caggcggagaagaagaagatggcgcagcagatgctggacctggaggaacagctggaggag
gaggaagctgcgaggcagaagctacagctcgagaaggtcacggccgaggccaagatcaag
aaactggaggatgagatcctggtcatggacgatcagaacaataagctgtcgaaggagcga
aaactccttgaagagaggatcagtgacctaactacgaatctcgcggaagaggaagaaaag
gccaaaaatcttaccaagctgaaaaataagcacgaatctatgatttcagaactggaagtg
cggctgaagaaggaggagaagagccggcaggagctggagaagctgaaacggaagctggag
ggcgaggccagcgacttccacgagcagatcgccgacctgcaggcgcagatcgccgagctc
aagatgcagctggccaagaaggaggaggagctgcaggcggccctggccaggctggacgac
gaaatcgctcagaagaacaatgccctgaagaagatccgggagctggagggccacatctcg
gacctgcaggaggacctggactcggaacgggccgccaggaacaaggccgagaagcagaag
cgagacctgggggaggagctggaggcgctgaagacggagctggaggacacgctggacagc
acggccacccagcaggagctccgggccaagagggagcaagaggtgacggtgctgaagaag
gccctggatgaggagacgcggtcgcatgaggcccaggtccaagagatgaggcagaagcac
acgcaggccgtggaggagctcaccgagcagctcgagcagttcaagagggccaaggccaac
ctcgacaagaacaagcagacgctggagaaggagaacgcagacctggcgggcgagctgcgg
ggcctgagccaggccaagcaggaggtggagcacaagaagaagaagctggaggcgcagctg
caggagctgcagtccaagtgcagcgacggggagcgggcccgggccgaactcagcgacaag
gtccacaagctgcagaacgaagtggagagtgtcacggggctgctcagcgaggcggagggc
aaggccatcaaactggccaaggatgtggccaccctggggtcccagctccaggacacgcag
gagctgcttcaagaagaaacccggcagaagctgaacgtgtccaccaagctgcgtcagctg
gaggacgagaggaacagcctgcaggaacagctggacgaggagatggaggccaagcagaac
ctggagcgccacatctcgactctgaacgtccagctctccgattccaagaagaagctgcag
gacttcgccagcacggtggaggccctggaagagggcaagaagaggtcccagaaggaactc
gaaggcctcacccagcagtacgaagagaaggccgctgcttacgacaaactggaaaagacc
aagaacaggcttcagcaggagctggacgacctggtcgtcgatttggacaaccagcggcaa
ctggtgtccaacctggaaaagaagcagaagaagttcgatcagctgctggccgaggagaag
accatctcttccaagtatgcggatgaaagggacagagccgaggcagaagccagggaaaag
gaaaccaaagccttgtctctggcgcgggccctcgaggaggccttggaagccaaggaggag
ctggagaggaccaacaagatgctcaaagccgagatggaggatctggttagctccaaggac
gacgtaggcaagaacgtccatgagctggagaagtccaagcgggccctggaaacccagatg
gaggagatgaagacccagctggaggagctggaggacgagctgcaggcgacagaagacgcc
aagctgcggctggaggtcaacatgcaggccctcaggggccagttcgagcgcgacctgcag
gcccgggatgagcagaacgaggagaagaggcggcagctccagaggcagctccacgagtac
gagacggaactggaggacgagcgcaagcagcgcgccctggcggccgcagccaagaagaag
ctggaaggggacctgaaagacctggagctgcaggcggactcggctgtcaaggggagggag
gaggccatcaagcagctgcgcaagctgcaggctcagatgaaggatttccagagagagctg
gaagactcccgcgcctccagagacgagatctttgccacggccaaagagaatgagaagaaa
gccaagagcttagaagctgacctcatgcagctgcaggaggatctagccgcggctgagagg
gctcgcaaacaggcagacctggagaaggaggaactggccgaggagctggccagcactgtg
tccggaaggaacacgctgcaggacgagaagcgccgcctggaggcccgcatcgcacagctg
gaggaggagctggaggaggagcagggcaacatggaggccatgagtgaccgcgtccggaag
gccacgcagcaggccgagcagctcagcaacgagctggccacggagcgcagcgcggctcag
aagaacgagagtgcccggcagcagctcgagcgccagaacaaggagctccggagcaagctg
caggagatggagggcgccgtcaagtccaagttcaagtccaccatcgccgccctggaggcc
aaggtcgcacagctggaggagcaggtggagcaggaggccagagagaagcaagcggccgcc
aagtcgctgaagcagaaggacaagaagctgaaggaggcgctgctgcaggtggaggacgag
cgcaaggccgccgagcagtacaaggagcaggcagagaaaggcaacgcaaaggtcaagcaa
ctcaaacggcagctggaggaggccgaggaggagtcccagcgcatcaatgccaaccgcagg
aagctgcagcgggagctggacgaggccacggagagcaacgaggccatgggccgcgaggtg
accgcgctcaagagcaagctcaggcgaggaaacgagacctccttcgtcccctctcgaagg
tctggaggacgcagggtcatcgaaaacgcggacggttctgatgaggaaatggacgctcgc
gacgcggacttcaacggaaccaaggccagtgaatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519230
Entry
107519230         CDS       T06036                                 

Gene name
MYH9
Definition
(RefSeq) myosin-9
  KO
K10352  myosin heavy chain 9/10/11/14
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04270  Vascular smooth muscle contraction
ray04530  Tight junction
ray04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107519230 (MYH9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107519230 (MYH9)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107519230 (MYH9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107519230 (MYH9)
   04147 Exosome [BR:ray04147]
    107519230 (MYH9)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     107519230 (MYH9)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   107519230 (MYH9)
SSDB
Motif
Pfam: Myosin_tail_1 Myosin_head Myosin_N Crescentin IQ CC2-LZ AAA_22
Other DBs
NCBI-GeneID: 107519230
NCBI-ProteinID: XP_016017169
LinkDB
Position
Unknown
AA seq 1960 aa
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVDMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKDERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQIGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIELIEKPAGPPGILALLDEECWFPKATDK
SFVEKVVQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEEGARQ
KLQLEKVTTEAKLKKLEEDQIILEDQNSKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLNDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQTLESERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVK
FNEGERVRTELADKVTKLQVELDNVTGLLTQSDSKSSKLTKDFSTLESQLQDTQELLQEE
NRQKLSLSTKLKQMEDEKNSFKEQLEEEEEAKRNLEKQMATLHAQVIDMKKKMEDGVGCL
ETAEEAKRKLQKDLEGLSQRFEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLE
KKQKKFDQLLAEEKSISAKYAEERDRAEAEAREKETKALSLARALEEATEQKAELERVNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLK
DLEAHIDSANKNRDEAIKQLRKLQAQMKDYMRELDDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELVNDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGT
VKSKYKASIAALEAKIAQLEEQLDNETKERQAACKQTRRTEKKLKDVLLQVDDERRNAEQ
FKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDLPFVVPRRMARKGTGECSDEEVDGKADGAEAKAAE
NT seq 5883 nt   +upstreamnt  +downstreamnt
atggcgcagcaagccgctgataagtatctctatgtggataaaaacttcatcaataacccg
ttggcccaggccgactgggctgccaagaagctggtatgggtgccttccgacaagagtggc
tttgagcccgccagcctcaaggaggaggtgggcgaggaggccatcgtggagctggtggag
aatgggaagaaggtgaaggtgaacaaggatgacatccagaagatgaacccgcccaagttc
tccaaggtggaggacatggcggagctcacgtgcctcaacgaagcctcagtgctgcacaac
ctcaaggagcgttactactcagggctcatctatacctattcaggcctgttctgtgtggtt
atcaatccttataagaacctgcccatctactccgaagagatcgtggacatgtacaagggc
aagaagaggcatgagatgccccctcacatctacgccatcacagacactgcctacaggagt
atgatgcaagaccgagaggaccagtccattttgtgcacgggtgagtctggagctggcaag
acggagaacaccaagaaagtcattcagtatctggctcacgtggcctcctcacacaagagc
aagaaggaccagggtgagctggagcggcagctgctgcaggccaaccccatcctggaggcc
ttcgggaatgccaagactgtgaagaacgacaactcctctcgattcggaaaattcattcgc
atcaactttgatgtcaatggctacatcgtgggagccaacatcgagacttatcttttggag
aaatctcgtgctatccgccaggccaaggacgagcggaccttccacatcttctactatctc
ctgtctggggctggggagcacctgaagactgatctcctgttggagccgtacaacaaatac
cgctttctgtccaatgggcacgtcaccattcccgggcagcaggacaaggacatgttccaa
gagaccatggaggccatgaggattatgggcatcccagaagaggagcaaataggcttgctg
cgggtcatctcgggggttcttcagctcggcaacatcgtcttcaagaaggagcgtaacact
gaccaggcatccatgcccgacaacacagctgcacaaaaagtgtcccacctcttgggtatc
aacgtgaccgatttcaccagaggaatcctcacgccccgcatcaaggtgggacgggattac
gtccagaaagcgcagaccaaggagcaggctgactttgccatcgaggccttggccaaggcc
acctacgagcgcatgttccgctggctggtgctgcgtatcaacaaggccctggacaagacc
aagcggcagggcgcctcgttcattgggatcctggacatcgccggcttcgagatcttcgat
ctgaactccttcgagcagctctgcatcaactacaccaacgagaagctgcagcagctcttc
aaccacaccatgttcatcctggagcaggaggagtaccagcgcgagggcatcgagtggaac
ttcatcgacttcggcctcgacctgcagccctgcatcgagctcattgagaagccagcaggc
ccccctggcatcctggccctgctggacgaggagtgctggttccccaaagccacggacaag
agcttcgtggagaaggtggtgcaggagcagggcacccacccgaagttccagaagcccaag
cagctgaaggacaaagccgatttctgcatcatccactacgctggcaaggtggattacaaa
gccgacgagtggctgatgaagaacatggaccccctgaacgacaacatcgctacgcttctg
caccagtcctccgacaagttcgtctcggagctgtggaaggatgtggaccgcatcatcggc
ctggaccaggtggccggcatgtctgagacggcgttgcccggggccttcaagacgcggaag
ggcatgttccgcaccgtggggcagctctacaaggagcagctggccaagctgatggccacg
ctgaggaacaccaaccccaacttcgtccgctgcatcatccctaaccacgagaagaaggct
ggcaaactggacccccacctggtgctggaccagctgcgctgcaacggggttctcgagggc
atccgcatctgccgccagggcttccccaaccgcgtggtcttccaggagttccggcagaga
tatgagatcctgacaccaaactccatccctaagggcttcatggacgggaagcaggcgtgc
gtgctcatgattaaagccttggagctcgacagcaatctgtaccgcatcggccagagcaaa
gtcttcttccgggccggcgtgctggcccacctggaggaggagcgcgacctgaagatcacc
gacgtcatcatcgggttccaggcctgctgcaggggctacctggcccgaaaggcctttgcc
aagcggcagcagcagctgacagccatgaaggtcctgcagaggaactgcgccgcctacctg
aagctgcggaactggcagtggtggcggctcttcaccaaggtcaagccgctactgcaggtg
agccggcaggaggaggagatgatggccaaggaggaggagctggtcaaagtccgagagaag
cagctggctgccgagaacaggctcacagagatggagacgctccagtcccagctcatggcg
gagaagttgcagctgcaggagcagctccaggcagaaacagaactgtgcgccgaggccgag
gagctccgggcccgcctgactgccaagaagcaggagctggaagagatttgccatgacctc
gaggccagggtggaggaagaggaggagcgctgccagcacctgcaggcggagaagaagaaa
atgcagcagaacatccaggaactggaggagcagctggaggaggaggagggcgcccgccag
aagctgcagctggagaaggtgaccaccgaggccaaactgaagaaactggaggaagaccaa
atcatcttggaagaccagaactccaaactggctaaggagaagaagctgttggaagacaga
atagccgagttcaccaccaacctcacagaagaggaggagaaatcaaagagcctcgcgaag
ctcaagaacaagcacgaggccatgatcaccgacctggaggagcgcctccgaagagaggag
aaacagcgtcaggagctggagaagactcgccggaagctggagggagactccacggacctc
aacgaccagatcgctgagctccaggctcagatcgctgagctcaagatgcagctggccaag
aaagaggaggagctccaggctgccctggccagagtggaggaggaagctgcccagaagaac
atggccctgaagaagatccgcgagctggagtctcagatctctgaactccaggaagacctg
gagtctgagcgcgcttctaggaataaagctgagaagcagaaacgggatctcggggaagag
ctggaggctctgaaaacagagttggaggacaccttggattctacggctgcccagcaggag
ctcaggtccaaacgcgaacaggaagtgaacatcctgaagaagaccctcgaggaagaggcc
aagacccatgaggcccagatccaggagatgagacagaagcactcacaggccgtggaggag
ctggctgagcagctggagcagacaaagcgggtaaaagccaaccttgagaaggccaaacag
accctggagagtgagcgaggggagctggccaacgaggtgaaggtcctgctgcagggcaaa
ggggactccgagcacaagcggaagaaagtggaggcccagctccaggagctgcaggtgaag
ttcaacgagggagagcgagtgcgcacggagctggccgacaaggtcaccaagcttcaggtc
gagctggacaatgtgacaggtcttctcacccagtctgacagcaagtctagcaagctcacc
aaggacttctccactctggagtcccagctgcaggacacgcaggagctgctgcaggaggag
aaccggcagaagctgagcctgagcaccaagctgaagcagatggaggacgagaagaattcc
ttcaaggagcagctggaggaggaggaggaggccaagcggaacctggagaagcagatggcc
accctccacgcccaggtgattgacatgaagaagaagatggaggatggtgtggggtgcctg
gagaccgccgaggaagccaagaggaagctccagaaggacctggaggggctgagccagcgc
tttgaggagaaggtggctgcctacgacaagctggagaagaccaagacgcgcctgcagcag
gagctggatgacctgctcgtggatctggaccaccagcggcagagtgtctccaacctggag
aagaagcagaagaagttcgaccagctcctggctgaggagaagagcatctctgccaagtac
gcggaggagcgtgaccgggctgaggcagaggcccgcgagaaggagaccaaggcgctgtcg
ctggcccgggccctggaggaggccacggagcagaaggcggagctggagcgggtcaacaag
cagttccgcaccgagatggaggacctcatgagctccaaggacgatgtgggcaagagtgtg
catgagctggagaagtccaagcgggccctggagcagcaggtggaggagatgaagacccag
ctcgaggagctggaggatgagctgcaggccactgaggatgccaagctgcggctggaggtg
aacctgcaggccatgaaggcccagttcgagcgggaccttcagggccgggatgagcagagt
gaggagaagaagaagcagctggtccgacaggtgcgggagatggaggcagagctggaggac
gagaggaagcagcgctcaatggcagtggccgctcggaagaagctggagatggacctgaag
gacctggaggcccacatcgactcggccaacaagaaccgagacgaagccatcaaacagctg
cggaagctgcaggcccagatgaaggactacatgcgtgagctggacgacacgcgggcctct
cgcgaggagatcctggcacaggccaaggagaatgagaagaagctgaagagcatggaggcc
gagatgatccagctgcaggaggaactggcagctgccgagcgtgccaagcgccaggcccag
caggagcgggatgagctggccgacgagattgctaacagcagcggcaaaggggctctggcg
ctggaggagaagcggcgcctggaggcccgcatcgcccagctggaggaggagctggaggag
gagcagggcaacacggagctggtgaacgaccggctgaagaaggccaacctgcagatcgac
cagatcaacaccgacctgaaccttgagcgcagccacgcccagaagaacgagaatgcgcgg
cagcagctggagcggcagaacaaggagctcaaggtcaagctgcaggagatggagggcacc
gtcaagtccaagtacaaggcctccatcgctgccctggaggccaagattgcacagctggag
gagcagctggacaacgagaccaaggagcgccaggcggcctgcaagcagacgcgtcggacc
gagaagaagctgaaggatgtgttgctgcaggtggatgatgagcgcaggaacgccgagcag
ttcaaggaccaggccgacaaggcgtccacccgcctgaagcagctcaagcggcagctggaa
gaggcggaggaggaggcccagcgggccaacgcctcccgccggaaactgcagcgcgagctg
gaggacgccaccgaaaccgccgacgccatgaaccgggaggtcagctccctcaagaacaag
ctcaggcgtggggacctgccgttcgtcgtgccccgccgaatggcccggaaaggcactggc
gaatgctcggacgaggaggtggacgggaaagccgacggggctgaggccaaagctgccgaa
taa

DBGET integrated database retrieval system