KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500417
Entry
107500417         CDS       T06036                                 

Gene name
PPP2R1A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04350  TGF-beta signaling pathway
ray04390  Hippo signaling pathway
ray04530  Tight junction
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray05142  Chagas disease
ray05160  Hepatitis C
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107500417 (PPP2R1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107500417 (PPP2R1A)
   04390 Hippo signaling pathway
    107500417 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    107500417 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    107500417 (PPP2R1A)
   04152 AMPK signaling pathway
    107500417 (PPP2R1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107500417 (PPP2R1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107500417 (PPP2R1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107500417 (PPP2R1A)
  09156 Nervous system
   04728 Dopaminergic synapse
    107500417 (PPP2R1A)
   04730 Long-term depression
    107500417 (PPP2R1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107500417 (PPP2R1A)
   05165 Human papillomavirus infection
    107500417 (PPP2R1A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107500417 (PPP2R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107500417 (PPP2R1A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107500417 (PPP2R1A)
   03036 Chromosome and associated proteins [BR:ray03036]
    107500417 (PPP2R1A)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107500417 (PPP2R1A)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107500417 (PPP2R1A)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107500417 (PPP2R1A)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L Spore_Cse60
Other DBs
NCBI-GeneID: 107500417
NCBI-ProteinID: XP_015981093
LinkDB
Position
Unknown
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcggccgctgacggtgacgactcgctctatcccatcgcggtgctcatagacgagctc
cgcaacgaggatgtgcagctccgcctcaacagcatcaagaagctgtccaccatcgccttg
gccctcggggtggagaggacccgcagcgagcttctgcccttcttgacagacaccatctac
gatgaggatgaggtcctcctggcgctggcggagcagctgggaaccttcaccaccctggtg
ggaggccccgagtacgtgcactgcctgctgccacccctggagtcactggccacagtggag
gagacggtggtgcgggacaaggcggtggagtccttgcgggccatctcgcacgagcactca
ccctctgacctggaggcccacttcgtgccgctggtgaagcggctggcgggcggcgactgg
ttcacctcccgcacctcggcctgcggcctcttctccgtctgctacccccgcgtgtccagc
gccgtcaaggccgagctccgacagtacttccggaacctgtgctcagatgacacccccatg
gtgcggcgggccgcagcttctaagctgggggagttcgccaaggtgctggagctggacaac
gtcaagagcgagatcatccctatgttctccaacctggcctctgacgagcaggactcggtg
cggctgctggcagtggaggcatgcgtgaacatcgctcagctgctgcctcaggaggacctg
gaggccctggtgatgcccaccctgcgccaggccgccgaagacaagtcgtggcgcgtgcgg
tacatggtggccgacaagttcacagagctccagaaagccgtggggcctgagatcaccaag
acggacctggtccccgccttccagaacctgatgaaagactgtgaggccgaggtgagggcc
gcagcctctcacaaggtcaaagaattctgtgaaaatctctctgccgactgccgggagaac
gtgatcatgacccagatcctgccgtgcatcaaggagctggtgtcagacgccaaccagcac
gtcaagtcggcactggcttcggtcattatgggcctctccccaatcctgggcaaggacaac
accattgagcacctcttgcccctcttcctggctcagctgaaggacgagtgcccggaggtg
cggctgaacatcatctccaacctggactgcgtcaacgaggtgatcggcatccggcagctg
tcccagtcgctgctccccgccatcgtggagctggcggaggatgccaagtggcgagtgcgg
ctggccatcatcgagtacatgcccctgctggctgggcagctgggggtggagttctttgac
gagaagctcaactccttgtgcatggcctggcttgtggatcatgtctatgccatccgcgag
gcagccaccagcaacctgaagaagctggtggagaagttcgggaaggagtgggcccacgcc
actattatccccaaggtcttggccatgtctggggaccccaactacttgcaccgcatgaca
acactcttctgcatcaatgtgctgtctgaggtctgcgggcaggacatcaccactaagcac
atgctgcccacggtcctgcgtatggcgggggaccccgttgccaacgtccgcttcaacgtg
gccaagtccctgcagaagataggtcccatcctggacaacagcacgctgcagagcgaggtc
aagcccatcctggagaagctgacgcaggaccaggacgtggacgtcaagtactttgcccag
gaggccctgactgtgctttctctcgcatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500870
Entry
107500870         CDS       T06036                                 

Gene name
PPP2R2B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04390  Hippo signaling pathway
ray04530  Tight junction
ray04728  Dopaminergic synapse
ray05142  Chagas disease
ray05160  Hepatitis C
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107500870 (PPP2R2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107500870 (PPP2R2B)
   04071 Sphingolipid signaling pathway
    107500870 (PPP2R2B)
   04151 PI3K-Akt signaling pathway
    107500870 (PPP2R2B)
   04152 AMPK signaling pathway
    107500870 (PPP2R2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107500870 (PPP2R2B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107500870 (PPP2R2B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107500870 (PPP2R2B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107500870 (PPP2R2B)
   05165 Human papillomavirus infection
    107500870 (PPP2R2B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107500870 (PPP2R2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107500870 (PPP2R2B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107500870 (PPP2R2B)
   03036 Chromosome and associated proteins [BR:ray03036]
    107500870 (PPP2R2B)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107500870 (PPP2R2B)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107500870 (PPP2R2B)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107500870 (PPP2R2B)
SSDB
Other DBs
NCBI-GeneID: 107500870
NCBI-ProteinID: XP_015982031
LinkDB
Position
Unknown
AA seq 509 aa
MLLSLPALHLQTSEYHPLFQLPHGRLGPWCSPTGSPAPLSCETGCGEGSWILVCRLLVPT
QVNLLSMEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLATGDKGGRVVIFQRE
QESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKT
VKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTY
HINSISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHH
CNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGR
YIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIM
TGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKK
ILHTAWHPSENIIAVAATNNLYIFQDKVN
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgcttctctcgttacctgccttacatcttcagacctccgaataccatcctctcttccag
ctgccacacggaaggctcggaccatggtgcagtcccactggctcccctgcccccctctcc
tgtgagactggctgcggggagggatcatggatacttgtctgccggcttctggttcccacg
caagtaaacctgctgtcaatggaggaggacattgatacccgcaaaatcaacaacagtttc
ctgcgcgaccacagctatgcgaccgaagctgacattatctctacggtagaattcaaccac
acaggagaattactagcgacaggggacaaggggggtcgggttgtaatatttcaacgagag
caggagagtaaaaatcaggttcatcgtaggggtgaatacaatgtttacagcacattccag
agccatgaacctgagttcgattacctgaagagtttagaaatagaagaaaaaatcaataaa
ataagatggctccctcagcagaatgcagcctacttccttctgtctactaatgataaaact
gtgaagctgtggaaagtcagcgagcgtgataaaaggccagaaggctacaatctgaaagat
gaggagggccggcttcgagatcctgccaccatcacaaccttgcgggtgcctgtgctgaga
cccatggacctgatggtggaggccaccccacgaagagtctttgccaacgcacacacgtat
cacatcaactccatatcagtcaacagcgactatgaaacctacatgtcagctgatgacctg
aggattaacctgtggaactttgaaataaccaatcaaagttttaatattgtcgacattaag
ccggccaacatggaggagctcacggaggtgatcacggcggctgagttccacccccatcac
tgcaacaccttcgtgtacagcagcagcaaagggacaatccggctgtgtgacatgagggca
tcggccctgtgtgacagacacaccaaattttttgaagagccggaagatccaagcaacagg
tcgtttttctctgaaatcatctcttcgatttccgatgtgaaattcagccacagtgggagg
tatatcatgaccagagactatctgaccgttaaagtctgggatctcaacatggaaaaccgc
cccatcgagacttaccaggttcatgactacctccgcagcaagctgtgctccctctacgaa
aacgactgcatttttgataaatttgagtgtgtgtggaatggctcagacagtgtcatcatg
accggctcgtacaacaacttcttcaggatgtttgaccgaaacacgaagcgtgacgtcacc
ctggaggcctcgagggaaaacagcaaacctcgggcgatcctaaaaccgcgcaaagtgtgc
gtggggggcaagcggagaaaagacgagatcagtgtggacagcctggactttagcaaaaag
atcttacatacggcttggcatccttcagaaaatattatagcggtggcggcaacaaataac
ctatatatattccaggacaaggttaactag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501966
Entry
107501966         CDS       T06036                                 

Gene name
PPP2R5D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04728  Dopaminergic synapse
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107501966 (PPP2R5D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107501966 (PPP2R5D)
   04151 PI3K-Akt signaling pathway
    107501966 (PPP2R5D)
   04152 AMPK signaling pathway
    107501966 (PPP2R5D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107501966 (PPP2R5D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107501966 (PPP2R5D)
  09156 Nervous system
   04728 Dopaminergic synapse
    107501966 (PPP2R5D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107501966 (PPP2R5D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107501966 (PPP2R5D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107501966 (PPP2R5D)
   03036 Chromosome and associated proteins [BR:ray03036]
    107501966 (PPP2R5D)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107501966 (PPP2R5D)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107501966 (PPP2R5D)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107501966 (PPP2R5D)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 107501966
NCBI-ProteinID: XP_015984121
LinkDB
Position
Unknown
AA seq 606 aa
MPYKLKKEKEPPKLAKGAAKPSSSGKDGGGENTEEAQPQPQPQPQPQPQPQPQSQPPSSN
KRPSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREE
LFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFS
VNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYID
QKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNG
IAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESS
LTEPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHF
QVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEM
NQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMET
ETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLT
ASQEAL
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgccctataaactgaagaaggagaaggagccccctaagcttgccaaaggtgcagccaaa
cccagcagctcgggcaaggatggtggaggcgagaacactgaagaggcccagccacagcca
cagccacagccacaaccgcagccacagccacagccccagtctcagccaccatcatccaac
aagcgtcccagcaacagcacaccaccccccacgcagctcagcaaaatcaagtactcaggg
gggccccaaattgtcaagaaggagcggcggcaaagctcctcccgcttcaacctcagcaag
aaccgggagttgcagaagcttcctgctctgaaagattcgccaacccaggagcgggaggag
ctgtttatccagaagctgcgccagtgctgtgtcctttttgactttgtgtcagacccactc
agtgacctcaaattcaaggaggtgaagcgggcaggactcaatgaaatggtggagtatatc
acccatagccgcgatgttgtcaccgaggccatttaccccgaggctgtcaccatgttttca
gtgaatctcttccggacactgccaccttcatcaaatcctactggtgccgagtttgaccca
gaggaagatgagcccactctggaagctgcgtggccacatctccagctcgtgtacgagttt
ttcttacgtttccttgagtctcctgatttccagccaaacatagccaagaagtacattgac
cagaagtttgtccttgctctcctggacctgtttgacagtgaggatcctcgagagcgggac
ttcctcaagaccatcttgcatcgcatctatggcaagtttttggggctccgggcttatatc
cgtaggcagatcaaccacatcttctacaggttcatctatgagacggagcatcacaatggg
attgctgagctcctggagatcctgggcagcatcatcaatggctttgccttgccccttaag
gaagagcataagatgttccttatccgtgtcctgcttccccttcacaaggtcaagtccctg
agtgtctaccaccctcagctggcatactgtgtggtacaattcttggagaaggaaagcagt
ctcactgagccggtgattgtgggacttctcaagttctggcccaagacccacagccccaag
gaggtgatgttcctgaatgagctagaggagattctagatgtcattgaaccttcagagttc
agcaaagtgatggaaccactcttccgccagcttgccaaatgtgtctccagcccccatttc
caggtggcagagcgtgcgctctattactggaacaacgagtacatcatgagcctgataagt
gacaatgctgcccgagtcctccccataatgttccctgcactctacaggaactccaagagc
cactggaacaagacaatccatggactgatctacaatgctctgaagttatttatggagatg
aatcagaagctgtttgatgactgcacacaacaatacaaggcagagaagcagaagggcagg
ttccgaatgaaggaaagagaagagatgtggcaaaagattgaggagctggcccgacttaat
ccccagtatcccatgttccgagctccgccaccactgcctcctgtgtactcaatggagaca
gagacccccactgcagaggacattcagcttctgaagaggacagtggagacagaggctgtg
cagatgctgaaggacatcaagaaggagaaagtgctgcttcggaggaagtcagagctgccc
caggacgtgtacaccattaaggcactggaggcgcataagcgggcagaagagttcttaact
gccagccaggaggctctctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505807
Entry
107505807         CDS       T06036                                 

Gene name
PPP2CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04136  Autophagy - other
ray04140  Autophagy - animal
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04350  TGF-beta signaling pathway
ray04390  Hippo signaling pathway
ray04530  Tight junction
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray05142  Chagas disease
ray05160  Hepatitis C
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107505807 (PPP2CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107505807 (PPP2CB)
   04390 Hippo signaling pathway
    107505807 (PPP2CB)
   04071 Sphingolipid signaling pathway
    107505807 (PPP2CB)
   04151 PI3K-Akt signaling pathway
    107505807 (PPP2CB)
   04152 AMPK signaling pathway
    107505807 (PPP2CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107505807 (PPP2CB)
   04136 Autophagy - other
    107505807 (PPP2CB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107505807 (PPP2CB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107505807 (PPP2CB)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107505807 (PPP2CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    107505807 (PPP2CB)
   04730 Long-term depression
    107505807 (PPP2CB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107505807 (PPP2CB)
   05165 Human papillomavirus infection
    107505807 (PPP2CB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107505807 (PPP2CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107505807 (PPP2CB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107505807 (PPP2CB)
   04131 Membrane trafficking [BR:ray04131]
    107505807 (PPP2CB)
   03036 Chromosome and associated proteins [BR:ray03036]
    107505807 (PPP2CB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107505807 (PPP2CB)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107505807 (PPP2CB)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     107505807 (PPP2CB)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107505807 (PPP2CB)
Membrane trafficking [BR:ray04131]
 Autophagy
  Other autophagy associated proteins
   Others
    107505807 (PPP2CB)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107505807 (PPP2CB)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107505807 (PPP2CB)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N
Other DBs
NCBI-GeneID: 107505807
NCBI-ProteinID: XP_015991635
LinkDB
Position
Unknown
AA seq 309 aa
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgacaaggcgttcaccaaggagctggaccagtgggtcgagcagctgaacgagtgt
aaacagctgaacgagaaccaagtgcggacgctgtgcgaaaaggctaaagaaattttaaca
aaagaatcaaatgtgcaagaggttcgctgtcctgttaccgtctgtggagatgtgcacggt
caattccatgatcttatggaactctttagaattggaggaaaatcaccagatacaaactat
ctattcatgggtgactatgtagacagaggttattattcagtggagactgtgactcttctt
gtggcattaaaggtgcgttatccagaacgcattacaatattgagaggaaaccatgaaagc
cgacaaattacccaagtatatggcttttatgatgaatgtctacggaagtatggaaatgcc
aatgtttggaaatattttacagatctatttgattatcttcctcttacagctttagtagat
ggacagatattttgcctccatggtggcctctctccgtccatagatacactggatcatata
agagccctggatcgtttgcaggaagttccacatgagggcccaatgtgtgatctgttatgg
tcagatccagatgatcgtggcgggtggggtatttcaccacgcggtgctggctacacattt
ggacaagacatttctgaaacatttaaccacgccaatggtctcacactggtttctcgtgct
caccaacttgtaatggagggatacaattggtgtcatgatcggaatgtggtgaccattttc
agtgcacccaattactgttatcgttgtgggaaccaggctgctatcatggaattagatgac
actttaaaatattccttccttcagtttgacccagcacctcgtcgtggagagcctcatgtt
acccggcgcaccccagactacttcctgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505863
Entry
107505863         CDS       T06036                                 

Gene name
PPP2R3B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta isoform X1
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04728  Dopaminergic synapse
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107505863 (PPP2R3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107505863 (PPP2R3B)
   04151 PI3K-Akt signaling pathway
    107505863 (PPP2R3B)
   04152 AMPK signaling pathway
    107505863 (PPP2R3B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107505863 (PPP2R3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107505863 (PPP2R3B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107505863 (PPP2R3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107505863 (PPP2R3B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107505863 (PPP2R3B)
   03036 Chromosome and associated proteins [BR:ray03036]
    107505863 (PPP2R3B)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107505863 (PPP2R3B)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107505863 (PPP2R3B)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107505863 (PPP2R3B)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_5 EF-hand_1 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 107505863
NCBI-ProteinID: XP_015991722
LinkDB
Position
Unknown
AA seq 579 aa
MPPGKVLQPVLKMKVDELFLCWLSESSTQRMLQDCLQRIKTPGRTETGAGDAGQPGPLSA
AAAPACKPRALDSQGAPSPAPASAALPLGAASSPRSGPHARGPRRSAGTRVVQAKKEEPR
PPASSQSIPAFYFPRGRPQGAGHVEAAIAAVEKTFAQFPHERATMEDMGRVARACGCPLY
WKGPLFCGAGGERTGSVSVHKFVAMWRKVLQNCHDAAARFVHLLMSPGCNYLVQEDFVPF
LQDVVDTHPGLAFLKEAADFHSRYITTVIQRIFYTVNRSWSGRITCAELRRSTFLQNVAL
LEEEADINQLTEFFSYEHFYVIYCKFWELDTDHDLLIDAQDLARHNDHAISSKMIDRVFS
GAVTRGRKVQKEGKISYADFVWFLISEEDKKTPTSIEYWFRCMDLDGDGVLSMFELEYFY
EEQCRRLDSMAIEALPFEDCLCQMLDLVKPQNEGKITLRDLKSCKLANVFFDTFFNIEKY
LDHEQREQASLLRESESEGPELSDWEKYAAEEYDILVAEEAAGEPWEDGYEAELSPVEHR
LSARRSPLAQRPFFEAPSTLGSVDLYDYECEDDDDLQPS
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgccgcccggcaaagtgctgcagccggtcctgaagatgaaggtggacgagctgttcctg
tgctggctcagcgagtccagcacgcagaggatgctccaggactgcctgcagaggatcaag
acgcccgggcggaccgagacgggcgctggggacgcggggcagcccgggcccctgtcagcg
gccgcagcccccgcctgcaagcccagagcgctcgatagccagggggcgcccagcccggcc
cccgcgtccgccgcgctgcccctgggggccgcctctagtcccaggagtgggccacacgcc
cgagggcctcgtagatccgcagggaccagagtagttcaggcgaagaaggaggagccacgg
ccccccgccagcagccagagcattcccgccttctacttcccccgaggccggccgcagggc
gcggggcacgtggaggccgctatcgccgcggtggagaagaccttcgcgcagttcccacac
gagcgggccaccatggaggacatgggccgcgtggccagggcctgcggctgccccctctac
tggaaggggcccctcttctgtggagccggcggggagcgcaccggctccgtctccgtccac
aagttcgtcgccatgtggaggaaggtcctgcagaactgtcacgacgccgccgcccggttc
gtccacctgctcatgagccccggctgcaactacctggtgcaggaggacttcgtgcccttc
ctgcaggacgtggtggacacgcaccccgggctggccttcctgaaggaggcggcggacttc
cactctcgctacatcaccaccgtcatacagaggatcttctacaccgtcaaccggtcctgg
tccgggaggatcacgtgcgcagagctgcggaggagcaccttcctgcagaacgtggcgctc
ctggaggaggaggcggacatcaaccagctgacggagttcttctcctacgagcacttctac
gtgatctactgcaagttctgggagctggacactgaccacgacctgctcatcgacgcgcag
gacctggcgcggcacaatgaccacgccatatccagcaagatgatcgacagggtcttctcg
ggagcggtgacgcgaggcagaaaggtgcaaaaggaaggaaaaataagctacgccgacttc
gtctggttcctgatctccgaggaggacaagaaaaccccgaccagcatcgagtactggttc
cgctgcatggacctggacggggacggggtgctgtccatgttcgagctggagtacttctac
gaggagcagtgtcgccggctggacagcatggccatcgaggccctgccctttgaggactgc
ctctgccagatgctggacctggtgaagccccagaacgaagggaagatcacgctgcgcgac
ctgaagagctgcaagctcgccaacgtcttcttcgacaccttcttcaacatcgagaagtac
ttggatcacgagcagagggagcaggcgtccttgctcagggagagcgagagcgaaggcccc
gagctctccgactgggagaagtacgcggccgaggagtacgacatcctggtggccgaggag
gctgcgggggagccctgggaggacgggtacgaggcggagctcagccccgtggagcacagg
ctgagcgcgcggcggtctccgctggcccagaggcccttcttcgaggcgccgtcgacgctg
ggctccgtcgacctgtacgactacgagtgcgaagacgacgacgacctgcagccctcgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506800
Entry
107506800         CDS       T06036                                 

Gene name
PPP2CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04136  Autophagy - other
ray04140  Autophagy - animal
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04350  TGF-beta signaling pathway
ray04390  Hippo signaling pathway
ray04530  Tight junction
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray05142  Chagas disease
ray05160  Hepatitis C
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107506800 (PPP2CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107506800 (PPP2CA)
   04390 Hippo signaling pathway
    107506800 (PPP2CA)
   04071 Sphingolipid signaling pathway
    107506800 (PPP2CA)
   04151 PI3K-Akt signaling pathway
    107506800 (PPP2CA)
   04152 AMPK signaling pathway
    107506800 (PPP2CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107506800 (PPP2CA)
   04136 Autophagy - other
    107506800 (PPP2CA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107506800 (PPP2CA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107506800 (PPP2CA)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107506800 (PPP2CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    107506800 (PPP2CA)
   04730 Long-term depression
    107506800 (PPP2CA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107506800 (PPP2CA)
   05165 Human papillomavirus infection
    107506800 (PPP2CA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107506800 (PPP2CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107506800 (PPP2CA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107506800 (PPP2CA)
   04131 Membrane trafficking [BR:ray04131]
    107506800 (PPP2CA)
   03036 Chromosome and associated proteins [BR:ray03036]
    107506800 (PPP2CA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107506800 (PPP2CA)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107506800 (PPP2CA)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     107506800 (PPP2CA)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107506800 (PPP2CA)
Membrane trafficking [BR:ray04131]
 Autophagy
  Other autophagy associated proteins
   Others
    107506800 (PPP2CA)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107506800 (PPP2CA)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107506800 (PPP2CA)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N YqzH
Other DBs
NCBI-GeneID: 107506800
NCBI-ProteinID: XP_015993143
LinkDB
Position
Unknown
AA seq 309 aa
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaaggtgttcaccaaggagctagaccagtggatcgagcagctgaacgagtgc
aagcagctctccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgtgcaagaggttcgatgtccagtcactgtctgtggagatgtgcatggg
caatttcatgatctcatggaactgtttagaattggtggcaaatcaccagatacaaattac
ttgtttatgggagattatgttgacagaggatattattccgttgaaacagttactctgctt
gtagcccttaaggttcgttaccgtgaacgtatcaccattctccgaggaaatcatgagagc
agacagattacacaagtatatggtttctatgatgagtgcttaaggaaatatggaaatgca
aatgtttggaaatattttacagatctttttgattatcttcctctcactgctttggtggac
ggtcagatcttctgtctacacggtggcctctcaccatccatagatacactggatcacatc
agagcgcttgatcgcctacaagaagttccccatgagggtccaatgtgtgacttgctgtgg
tcagatccagatgaccgtggtggttggggtatatctcctcgaggagctggttacaccttt
ggacaagatatttctgagacatttaatcatgccaatggcctcacactggtgtctagagct
caccagctggtgatggagggatataactggtgccatgaccggaatgtagtaacgattttc
agtgctccaaactattgttatcgttgtggtaaccaagctgcaatcatggaacttgatgat
actctaaaatactctttcttgcagtttgacccagcacctcgtagaggcgagccacatgtt
actcgtcgtaccccagactacttcctgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508495
Entry
107508495         CDS       T06036                                 

Gene name
PPP2R3A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha isoform X1
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04728  Dopaminergic synapse
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107508495 (PPP2R3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107508495 (PPP2R3A)
   04151 PI3K-Akt signaling pathway
    107508495 (PPP2R3A)
   04152 AMPK signaling pathway
    107508495 (PPP2R3A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107508495 (PPP2R3A)
  09156 Nervous system
   04728 Dopaminergic synapse
    107508495 (PPP2R3A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107508495 (PPP2R3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107508495 (PPP2R3A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107508495 (PPP2R3A)
   03036 Chromosome and associated proteins [BR:ray03036]
    107508495 (PPP2R3A)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107508495 (PPP2R3A)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107508495 (PPP2R3A)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107508495 (PPP2R3A)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 DUF4116 DUF4187
Other DBs
NCBI-GeneID: 107508495
NCBI-ProteinID: XP_015995840
LinkDB
Position
Unknown
AA seq 1140 aa
MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFAHGVDCIVVHHSVCADLLHIPV
SQFKDADLDSMFLPHENGFSSAESDYPHQALTGIPKVKKGATFQNTCNLKDIAGEAISFA
SGKIKEFSLEKLKNSNHAAYKKGRKVKSDSFNRRSVDFDLLCGHYNNDGNSSSFGLLRSS
SVEEKSLSHRNSLDMNLTSMFLHNFSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCS
EDLKKCTDIIKQCIKKKSGSSINEGNGNDAVSSSETVYMNVMTRLASYLKKLPFEFMQSG
NNEAVDLTELLSNMPSLQLPPFSPIFGTEQPPKYEDVVQLSVPDHGQFQTVELEDDKHSS
RKTDTVKSFPNNSTNSLCNLEVNDPRALKDVQHESQPLTMKPLENVSSGDLMETLYIEEE
SDGKKALDKGLRTVNGPSQELLKVNEDRAELSDHSAHPKKCPASVHNEIGKIFEKPVINL
PKEDLKSKVPKVKEGDHRDFMNPNSQEEIDKLLMDLESFSQKMETSLREPLAKGKSSNSP
NSHSQLPGQQTIDLEPKPSCLTRIIETNGHKIEEEDRALLLRILGSIEDFAQELVECKSG
RGSLSQEKEMMQILQETLTNSSQANLSVCRSPAVDKAKDSTSVVLIQQTPEVIKIQNKPE
KKPGTPLPPPAAFPSGPQPLSPVPRVNNVVNAPLSINIPQFYFPEGLPDACSNHEQTLSR
IETAFMETEDQKADIYEMGKIAKVCGCPLYWKAPMFKAAGGEKTGFVSAQSFIAMWRKLL
NNHHDDASKFICLLAKPSCNSLEQEDFIPLLQDVVDTHPGLTFLKDAPEFHSRYITTVIQ
RIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFYVIYCKFWELD
NDHDLCISQADLSRYNDQALSNRIIERIFSGAVTRGKTVQKEGRMSYADFVWFLISEEDR
RNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDLLCQMLDLVKP
ASEGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAIQKDVENDVPEPSDWDRFAA
EEYETLVAEESAQAQFQEGTFEDYETEEPASPSEIGNKGNKIVTSSLAEKCGKLQSVDEE
NT seq 3423 nt   +upstreamnt  +downstreamnt
atggcagcaacttacagacttgtggttagtactgtgaaccactacagcagcgtggtgata
gaccggcgttttgagcaagctatacattattgcactggaacctgccacaccttcgcacac
ggggtcgactgcattgtggtacatcatagtgtttgtgcagacctcttacacatccctgtg
tctcagttcaaagatgcggatctggactctatgtttctaccccacgaaaatgggttttcc
tcagctgaaagtgactatcctcatcaggccctcacgggcatacctaaagtcaagaaagga
gctacatttcagaacacctgtaacttaaaggacattgcaggagaagcaatcagttttgcc
agtgggaaaataaaagaattttcccttgaaaaactcaaaaattctaaccacgcagcttac
aaaaagggaaggaaagttaagtctgactcatttaataggaggtcagttgattttgacttg
ctctgtggccattataacaatgatgggaactcttcatcctttggtttactccggagttct
tcagttgaggaaaaatctttgtcccataggaattcacttgatatgaacttgacttcgatg
tttcttcacaacttctctgaagaagacctggttactcaaattttggaaaaacataaaata
gataatttttcttctggaacagacataaagatgtgcttggacattttgctgaaatgctct
gaggatttaaaaaaatgcacagacatcataaaacagtgcataaagaaaaaatcagggagt
agcatcaatgaaggaaatggtaatgatgcagtttctagttctgaaactgtctatatgaat
gtaatgaccaggttagcatcctatctgaaaaagctaccatttgagttcatgcaatctggg
aataatgaggctgtagatttaacagaactgctcagcaatatgcctagtttacaactgcct
cccttctctccaatattcggcactgaacagcctcctaaatatgaagatgttgtacagctg
tcagtccctgaccatggacagtttcaaactgtagaattggaagatgacaagcacagttct
aggaaaacagacactgtaaaatcctttccaaacaactctacaaattccttatgtaactta
gaggttaatgatcccagggctctaaaagatgtccagcatgaatcacagccattaaccatg
aaacctttagaaaatgtttcctctggtgacctaatggaaaccctttatattgaagaagag
tcagatggaaagaaggcattagataaaggactaaggacagtgaatggacccagtcaggag
ttgttaaaggtaaatgaagatagagcagaattatcagaccatagtgctcatccaaaaaaa
tgtcctgcttcagtgcacaatgaaattggtaagatatttgagaaacctgtcattaatcta
cctaaggaagatcttaaatcaaaagttcctaaagtcaaagagggagatcacagagatttt
atgaatcctaacagtcaggaagaaatagataaattgttaatggatttggaatctttttca
cagaaaatggagacctctctaagggagccacttgccaaaggtaaaagctctaactctcca
aatagccatagtcagttgcctggtcagcaaactatagatctggagcctaaaccttcctgt
ctaacaagaattattgaaaccaatggacacaaaatagaggaagaggatcgagccctctta
ctgcgaattctaggaagtattgaagactttgctcaagaactagttgaatgcaaatcaggc
agagggagcctatcacaagaaaaggaaatgatgcaaattctacaggaaaccttgacgaat
tcctcccaggccaatttatctgtctgtagaagtcctgctgtcgataaagccaaagattct
acttcagtggttttgattcagcagaccccagaggttatcaagattcaaaataaaccagaa
aagaaacctggaacaccacttccacctccagccgcctttccaagtggtccccaaccgctc
tcccctgttcctcgtgtgaataacgttgtgaatgcacccttgtccataaacattccacag
ttctactttcctgaaggactcccagatgcctgcagcaaccatgaacagacactcagcaga
attgaaactgctttcatggagaccgaagatcagaaagcagatatctatgaaatgggaaaa
attgcaaaggtctgtggctgtcctctctattggaaagccccaatgttcaaggccgcaggg
ggagagaagacaggatttgtgtcagcacagtcattcattgccatgtggagaaagttgctg
aataatcatcatgatgatgcctcgaagtttatctgtcttctagcaaaacccagctgtaac
tctctagaacaggaggattttatccctttacttcaggacgtggtggatacacaccctggc
ctcacgttcctgaaagatgctccagaattccactcccgctacattaccacggttattcag
agaatattctacacagtcaacagatcttggagtggaaaaattacttcaacagagataaga
aaaagcaactttttgcaaactctagcccttttggaagaagaggaagatataaaccaaatc
acagactacttctcctatgaacatttttatgttatttattgtaaattctgggagctagat
aatgatcatgacctctgcatcagccaggccgatctgtctcgatacaatgaccaggctttg
tcaaacaggattattgaaaggatattctctggggcagtaacaaggggaaaaacagtacag
aaagagggaagaatgagttatgcagattttgtttggtttttgatctctgaggaagacaga
aggaaccccaccagcattgagtattggttccgctgcatggatgtggatggggatggtgta
ctctccatgtacgagctggagtacttctacgaggagcaatgtgaacgtatggaagccatg
ggcattgagcccttgccattccatgatttgctctgccaaatgcttgacctagtgaagcca
gccagtgagggcaaaataactctacgagatctgaagagatgcagaatggctcacatcttt
tatgacactttctttaatctggagaaatacttagaccatgaacagagagatccctttgca
atccagaaggatgttgaaaatgatgtgcctgagccttctgactgggacaggtttgctgct
gaggagtatgagactcttgtagcagaggagtctgcacaagcacagttccaggaaggcact
tttgaagattatgaaactgaggaacctgcctctccctcggaaattggaaacaaaggcaat
aaaatagtaacctcaagccttgcagagaaatgtggaaagcttcagtcagtggatgaagaa
taa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509328
Entry
107509328         CDS       T06036                                 

Gene name
PPP2R5E
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04728  Dopaminergic synapse
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107509328 (PPP2R5E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107509328 (PPP2R5E)
   04151 PI3K-Akt signaling pathway
    107509328 (PPP2R5E)
   04152 AMPK signaling pathway
    107509328 (PPP2R5E)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107509328 (PPP2R5E)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107509328 (PPP2R5E)
  09156 Nervous system
   04728 Dopaminergic synapse
    107509328 (PPP2R5E)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107509328 (PPP2R5E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107509328 (PPP2R5E)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107509328 (PPP2R5E)
   03036 Chromosome and associated proteins [BR:ray03036]
    107509328 (PPP2R5E)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107509328 (PPP2R5E)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107509328 (PPP2R5E)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107509328 (PPP2R5E)
SSDB
Motif
Pfam: B56 SBF2 Sec7_N
Other DBs
NCBI-GeneID: 107509328
NCBI-ProteinID: XP_015997274
LinkDB
Position
Unknown
AA seq 467 aa
MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQP
ELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVS
CNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKF
VLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAE
LLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPSLTE
PVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCVSSPHFQVA
ERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNSA
MFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcctcagcaccaactactcctccatcagtggataaagtagacggattttctcggaag
tccgtcagaaaagccagacagaagaggtcgcaaagttcctcacagtttaggtctcaaggc
aagcctattgagttaacacctctgcctctcctgaaagacgttccatcctcagagcagcct
gaactgttcctaaagaaacttcagcagtgctgtgtcatttttgacttcatggacacgcta
tctgatcttaaaatgaaagaatacaagcgctccactcttaatgaactggtggactacatt
acaataagcagaggctgtttgacagagcagacttaccctgaagtagttagaatggtatct
tgcaatatattcagaactctccctcctagtgacagcaatgaatttgatccagaagaagat
gaacctaccctggaggcatcctggccacatttacagcttgtatatgaatttttcatacga
tttttggaaagccaagaattccaacccagcattgccaaaaaatacatagatcagaaattt
gtattacagcttttggagctatttgacagtgaagaccctcgggaacgagactacttaaaa
acagtcttacacagaatttatggcaagtttcttggtcttagagcatttatccgaaaacag
attaacaatatttttctaaggtttgtttatgaaacagaacacttcaatggtgtagctgaa
ctgctggaaatattaggaagtattatcaatggcttcgctttacctcttaaggcagaacac
aaacagtttctggtgaaagtgttgatccctttgcacactgtcaggagcttatcactcttc
catgcccagctggcgtattgcatagtacagtttctggagaaagacccttcactaacagaa
ccagttattagagggttaatgaaattttggcccaaaacatgtagtcaaaaagaggtcatg
ttccttggggagctggaagagatattggatgtgattgaaccttcacagtttgttaaaatt
caagaacctttgtttaaacaaattgccaagtgtgtatctagcccccattttcaggtggca
gaaagggcactctattattggaataatgaatacatcatgagtttgatagaagaaaactct
aatgtcatccttcccatcatgttttccagtctttataggatttcaaaagaacattggaac
ccggctatcgtggcattagtctacaatgtgttgaaggcatttatggagatgaacagcgcc
atgtttgatgagctgacagccacatacaagtcagatcgtcagcgtgagaaaaagaaagaa
aaggagcgtgaagaattatggaaaaaactggaggatctggagttgaagagaggtcttaga
cgtgatgggataattccaacctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514412
Entry
107514412         CDS       T06036                                 

Gene name
PPP2R3C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma isoform X1
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04728  Dopaminergic synapse
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107514412 (PPP2R3C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107514412 (PPP2R3C)
   04151 PI3K-Akt signaling pathway
    107514412 (PPP2R3C)
   04152 AMPK signaling pathway
    107514412 (PPP2R3C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107514412 (PPP2R3C)
  09156 Nervous system
   04728 Dopaminergic synapse
    107514412 (PPP2R3C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107514412 (PPP2R3C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107514412 (PPP2R3C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107514412 (PPP2R3C)
   03036 Chromosome and associated proteins [BR:ray03036]
    107514412 (PPP2R3C)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107514412 (PPP2R3C)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107514412 (PPP2R3C)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107514412 (PPP2R3C)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_13 EF-hand_1 EF-hand_5 DUF61
Other DBs
NCBI-GeneID: 107514412
NCBI-ProteinID: XP_016007566
LinkDB
Position
Unknown
AA seq 453 aa
MDWKEVLRRRLATPNTGPNRKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFY
YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINY
ESFLKVGEKAGPKCKQFFTAKVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLY
DVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKI
QDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSR
YGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGY
LNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV
TTILIDLNGFWTYENREALVANDNENSAELDDT
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggactggaaagaagttcttcgtcggcgattagcgacgcccaacaccggaccaaacaga
aaaaaaagtgaacaagagttaaaagatgaagaaatggatttatttaccaaatattactca
gaatggaaaggaggtagaaaaaacacaaatgaattctataagaccattccccggttttat
tataggctgccagctgaagatgaagtcttattacagaaattaagagaagaatccagagct
gtctttctgcaaaggaaaagcagagaactgttagataatgaagaattacagaacttatgg
tttttgctggacaagcaccagacaccacctatgattggagaggaagcaatgattaattat
gaaagttttttgaaagttggtgaaaaagctggaccaaagtgcaagcaatttttcacagca
aaagtctttgctaaactccttcatacagattcttatggaagaatttccatcatgcagttc
tttaattatgtcatgagaaaagtttggcttcatcaaacaaggataggactcagtttatat
gatgttgcaggacaggggtaccttcgggaatccgatttagaaaactacatattggaactt
atccctactttgccacaattagatgggctggaaaaatctttttactccttttatgtttgt
acagcagttaggaaattcttcttctttttagaccctctaagaacagggaagataaaaatt
caagatattttagcatgcagcttcctagatgatttattggagttaagggatgaggaactg
tccaaggagagtcaagaaacaaactggttttctgctccttctgccctaagggtatatggc
cagtatttgaatcttgataaggatcacaatggcatgctcagtaaagaagaactctcccgc
tatggaacagcaaccatgaccaatgtcttcttagaccgtgttttccaggagtgtcttact
tatgatggagaaatggactataagacctacctggattttgttcttgcattagaaaaccga
aaagaacctgcagctctgcaatatattttcaaattgcttgatattgaaaacaaaggatac
ctgaatgtcttttcccttaattatttctttcgggctatacaggaactaatgaaaatccat
ggacaagatcctgtttcatttcaagatgtcaaggatgaaatctttgacatggtaaaacca
aaagatcctttgaaaatctctcttcaggatttaatcaacagtaatcagggagacacagtc
accaccattctaattgatctgaatggcttttggacttatgagaacagagaagcccttgtt
gcaaatgacaatgaaaactctgcagagcttgatgatacatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515450
Entry
107515450         CDS       T06036                                 

Gene name
PPP2R2A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04390  Hippo signaling pathway
ray04530  Tight junction
ray04728  Dopaminergic synapse
ray05142  Chagas disease
ray05160  Hepatitis C
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107515450 (PPP2R2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107515450 (PPP2R2A)
   04071 Sphingolipid signaling pathway
    107515450 (PPP2R2A)
   04151 PI3K-Akt signaling pathway
    107515450 (PPP2R2A)
   04152 AMPK signaling pathway
    107515450 (PPP2R2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107515450 (PPP2R2A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107515450 (PPP2R2A)
  09156 Nervous system
   04728 Dopaminergic synapse
    107515450 (PPP2R2A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107515450 (PPP2R2A)
   05165 Human papillomavirus infection
    107515450 (PPP2R2A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107515450 (PPP2R2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107515450 (PPP2R2A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107515450 (PPP2R2A)
   03036 Chromosome and associated proteins [BR:ray03036]
    107515450 (PPP2R2A)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107515450 (PPP2R2A)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107515450 (PPP2R2A)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107515450 (PPP2R2A)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 107515450
NCBI-ProteinID: XP_016009776
LinkDB
Position
Unknown
AA seq 447 aa
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggagggaatgatattcagtggtgtttttctcaggtgaaaggagca
gtagacgatgatgtagcagaagcagatataatttctacagtagaatttaatcattctgga
gaattactagcaacaggagataaaggtggtagagtcgtcatctttcaacaggagcaggag
aacaaaatccagtctcatagcagaggagaatataatgtttacagcacctttcagagccat
gaaccagagtttgactacttgaaaagtttagaaatagaagaaaagatcaacaaaattagg
tggttaccccagaaaaatgctgctcagtttttattgtctaccaatgataaaacaataaaa
ttatggaaaatcagtgaaagggacaaaagacccgaagggtataacttgaaagaggaagat
ggaaggtatagagatcctactacagtcactacactacgagtgccagtttttaggcccatg
gatctaatggttgaggccagtccacgaagaatatttgccaatgctcatacatatcacatc
aactcaatttctattaatagtgattatgaaacatatttatctgcagatgatttgaggatt
aacctttggcatctggaaattacagacaggagttttaatattgtggatattaagcctgcc
aatatggaagagctaacagaggtgattacagcagcagaattccatccaaacagctgtaac
acgtttgtatacagcagcagtaaaggaactattcggttatgtgacatgagggcatccgcc
ctctgtgatagacattctaaattgtttgaagaacctgaagatcccagcaacaggtctttt
ttttctgaaattatctcctctatttccgatgtaaaattcagccatagtggtcgatatatg
atgactagagactatttgtcagtcaaaatttgggacttaaatatggaaaacaggcctgtc
gaaacataccaggtgcatgaatacctcagaagtaaactttgttcactgtatgaaaatgac
tgcatatttgacaaatttgaatgttgttggaatggatctgatagtgttgtcatgactgga
tcttacaataatttcttcaggatgtttgacaggaacacaaagcgagacataaccctagaa
gcatcacgggaaaacaacaaacctcgcacggttctgaagccacgcaaagtgtgtgcaagt
ggcaagagaaagaaagatgaaataagtgttgacagcctagacttcaacaagaaaatactt
cataccgcctggcaccccaaggaaaatatcattgctgtagctactacaaacaatctgtat
atatttcaagacaaagtgaattag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517041
Entry
107517041         CDS       T06036                                 

Gene name
PPP2R5B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04728  Dopaminergic synapse
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107517041 (PPP2R5B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107517041 (PPP2R5B)
   04151 PI3K-Akt signaling pathway
    107517041 (PPP2R5B)
   04152 AMPK signaling pathway
    107517041 (PPP2R5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107517041 (PPP2R5B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107517041 (PPP2R5B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107517041 (PPP2R5B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107517041 (PPP2R5B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107517041 (PPP2R5B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107517041 (PPP2R5B)
   03036 Chromosome and associated proteins [BR:ray03036]
    107517041 (PPP2R5B)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107517041 (PPP2R5B)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107517041 (PPP2R5B)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107517041 (PPP2R5B)
SSDB
Motif
Pfam: B56 FTCD_C
Other DBs
NCBI-GeneID: 107517041
NCBI-ProteinID: XP_016012836
LinkDB
Position
Unknown
AA seq 509 aa
METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELT
PLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGV
LIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPD
FQPSVAKRYVDQKFVLMVKWGAEAGWYHGLLELFDSEDPREREYLKTILHRVYGKFLGLR
AYIRKQCSHIFLRFIYELEHFNGVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSV
KSLSVFHAQLAYCVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEP
SQFVKIQEPLFKQVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQV
SKEHWNQTIVSLIYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELR
LRRLQGTQGAKEAPLQRLTPPVAASGGQS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggagacgaagctgcccccggcaagcacccccaccagcccctcttctccagggctatcg
cctgtgcccccacccgacaaggtggatggtttctcccgccgttccctccgcagggcccgg
cccaggcgctcccatagttcctctcagttccgctatcagagcaaccagcaggagctcact
ccactgcccctgctcaaagatgtgccagcttctgagctgcatgagctgctgagcaggaag
ctggcccagtgcggggtgatgtttgacttcttggactgtgtggccgaccttaaggggaag
gaggtgaagcgggcagccctcaatgagctggtggagtgcgtggggagcacccgtggggtc
ctcattgagcccgtctacccagacatcatccgcatgatctcagtgaatatcttccggacc
ctgccacccagtgagaaccctgaatttgaccctgaagaggatgagcccaaccttgagcct
tcgtggccacatctgcagctggtatatgagtttttcctgcgtttcttggagagcccagac
ttccagccctccgtggccaagagatatgtggatcaaaagtttgtcctgatggtgaagtgg
ggagccgaggctgggtggtaccatgggcttctggagctgtttgatagtgaggacccccgg
gagcgtgagtacctcaagaccatcctgcaccgggtctatggcaagttcctggggctccgg
gcctatatccgcaaacagtgcagccacatctttctcaggttcatctatgaactcgagcac
ttcaatggcgtggctgagctactggagatcttagggagcatcatcaatggctttgcgctg
cccctgaagactgagcacaagcagttcctggtccgggtcctgattcccctgcactctgtc
aagtcactgtctgtctttcatgcccagctggcgtactgcgtggtgcagttcctggagaag
gatgccaccttgacagagcatgtcatccgggggctgctcaaatactggccaaaaacctgc
acccagaaggaggtgatgtttctgggggagatggaagagatccttgatgtcattgagccc
tcccagtttgtgaagatccaggagcccctctttaagcaggtggctcgctgtgtgtctagc
ccccatttccaggttgcagagcgggctctgtatttctggaacaatgagtatatcctgagc
ctcattgaggacaactgccacactgtgctgcctgctgtctttgggaccctctaccaagtc
tccaaggagcactggaatcaaaccatcgtatctctgatctataacgtgctcaagaccttc
atggagatgaatgggaagctgttcgatgagctcacagcctcctacaagctggaaaagcag
caggagcagcaaaaggcccaggaacgtcaggagctgtggcaaggcctggaggagctacgg
ctacgccggttacaggggacccagggagccaaagaggcccccctccagcgccttacaccc
ccggtggccgccagtgggggtcagagctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519027
Entry
107519027         CDS       T06036                                 

Gene name
PPP2R2C
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, gamma isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04390  Hippo signaling pathway
ray04530  Tight junction
ray04728  Dopaminergic synapse
ray05142  Chagas disease
ray05160  Hepatitis C
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107519027 (PPP2R2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    107519027 (PPP2R2C)
   04071 Sphingolipid signaling pathway
    107519027 (PPP2R2C)
   04151 PI3K-Akt signaling pathway
    107519027 (PPP2R2C)
   04152 AMPK signaling pathway
    107519027 (PPP2R2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107519027 (PPP2R2C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107519027 (PPP2R2C)
  09156 Nervous system
   04728 Dopaminergic synapse
    107519027 (PPP2R2C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107519027 (PPP2R2C)
   05165 Human papillomavirus infection
    107519027 (PPP2R2C)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107519027 (PPP2R2C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107519027 (PPP2R2C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107519027 (PPP2R2C)
   03036 Chromosome and associated proteins [BR:ray03036]
    107519027 (PPP2R2C)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107519027 (PPP2R2C)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107519027 (PPP2R2C)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107519027 (PPP2R2C)
SSDB
Other DBs
NCBI-GeneID: 107519027
NCBI-ProteinID: XP_016016728
LinkDB
Position
Unknown
AA seq 447 aa
MGEDTDTRKINHSFLRDHSYVTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRVFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAVTDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHAKLFEEPEDPSNRSFFSEITSSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDVSVDSLDFGKKILHTAW
HPAENVIAIAATNNLYIFQDKVNSEMH
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggcgaggacacggacacgcggaaaattaaccacagcttcctgcgcgaccacagctat
gtgaccgaagccgatgtcatctctactgtggaattcaaccacaccggagagctgctggcc
acgggcgacaagggcggccgggtcgtcatcttccagcgggagccagagagtaaaaacgcg
cctcacagccagggcgagtacgacgtctacagcactttccagagccacgagccggagttc
gactatctcaagagcctggagatagaggagaaaatcaacaagatcaaatggctcccgcag
cagaatgccgcccactccctcctgtccaccaacgataaaactatcaaattatggaagatt
accgaacgagataaaaggcccgagggctataacctgaaggacgaagaagggaagcttaaa
gacctgtccacagtgacgtcactacaggtgccggtgctgaagcccatggacctgatggtg
gaggtgagcccgcggagggtcttcgccaacggccacacctaccacatcaactccatctcc
gtcaacagcgactgcgagacctacatgtcggcggacgacctgcgcatcaacctctggcac
ctggctgtcaccgaccggagcttcaacatcgtggatatcaagccggccaacatggaggac
ctcacggaggtgatcacggcgtccgagttccacccgcaccactgcaacctgttcgtgtac
agcagcagcaagggcagcctgcgcctctgcgacatgcgggcggccgccctgtgcgacaag
cacgccaaactcttcgaggagcccgaggaccccagcaaccgttccttcttctcggaaatc
acctcctccgtgtccgacgtgaagttcagccatagcggccggtacatgctcacccgggac
tacctcacggtcaaggtctgggacctgaacatggaggcgaggcccatcgagacctaccag
gtccacgattaccttcggagcaagctctgttccctctatgagaacgactgcattttcgac
aagttcgaatgtgcctggaacgggagcgacagcgtcatcatgaccggcgcctacaacaac
ttcttccgcatgttcgaccgcaacaccaagcgggacgtgacgctcgaggcctcccgggag
agcagcaagccgcgggccgtgctcaagccgcggcgcgtgtgcgtgggcggcaagcgccgg
cgggacgacgtcagcgtggacagcctggacttcggcaagaagatcctgcacacggcctgg
cacccggccgagaacgtcatcgccatcgcggccaccaacaacctgtacatcttccaggac
aaggtgaactccgagatgcactag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521184
Entry
107521184         CDS       T06036                                 

Gene name
PPP2R1B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform isoform X1
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04350  TGF-beta signaling pathway
ray04390  Hippo signaling pathway
ray04530  Tight junction
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray05142  Chagas disease
ray05160  Hepatitis C
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107521184 (PPP2R1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107521184 (PPP2R1B)
   04390 Hippo signaling pathway
    107521184 (PPP2R1B)
   04071 Sphingolipid signaling pathway
    107521184 (PPP2R1B)
   04151 PI3K-Akt signaling pathway
    107521184 (PPP2R1B)
   04152 AMPK signaling pathway
    107521184 (PPP2R1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107521184 (PPP2R1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107521184 (PPP2R1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107521184 (PPP2R1B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107521184 (PPP2R1B)
   04730 Long-term depression
    107521184 (PPP2R1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107521184 (PPP2R1B)
   05165 Human papillomavirus infection
    107521184 (PPP2R1B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107521184 (PPP2R1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107521184 (PPP2R1B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107521184 (PPP2R1B)
   03036 Chromosome and associated proteins [BR:ray03036]
    107521184 (PPP2R1B)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107521184 (PPP2R1B)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107521184 (PPP2R1B)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107521184 (PPP2R1B)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N M11L CLASP_N IFRD AEP1 DUF3730
Other DBs
NCBI-GeneID: 107521184
NCBI-ProteinID: XP_016021135
LinkDB
Position
Unknown
AA seq 476 aa
MVRRAAASKLGEFAKVLELDSVKSEIVPLFTNLASDEQDSVRLLAVEACVSIAQLLSQDD
LEILVMPTLRQAAEDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQNLLKDCEAEVR
AAAAHKVKELCENLPIEGRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKE
NTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRV
RLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGIEWAQ
SAIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFN
VAKSLQKIGPILDIDALQEEVKPVLQKLGQDEDMDVKYFAQEAISVVAQRLRKLDFPVKD
SEEPSAPGADKNHFLRPRGPGEDTRKGPAYQLHVNARDTLAQLEIAELVHFSQSRE
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggtacgtcgtgctgctgcttccaaattgggcgaatttgcaaaagttttagagttagac
agtgtgaaaagcgaaattgttccattgttcactaatctagcttcagatgaacaggattcg
gtgcgcctcttagctgtagaagcttgtgtcagtattgctcagctactgtctcaggacgac
cttgagattctggtgatgcctacacttcgacaagcagcggaagataaatcttggcgagtt
cgctatatggtagctgacaaattttcagagcttcagaaagctgtgggtcctaaaatcacg
ctaaacgacctcatccccgcctttcagaacctacttaaagactgtgaagctgaagtccga
gcagctgctgcccacaaagtaaaagaactttgtgagaacttgcccattgaaggtagagag
accataattatgaatcaaattctgccctatattaaggaattagtatctgatacaaatcaa
catgtcaaatcagctctagcttctgtaattatgggattgtctaccattttgggcaaagag
aataccattgaacatcttctacctctttttttagctcagttaaaggatgagtgtcctgaa
gttcgtctcaatatcatctccaatttggattgtgtaaatgaagtaattggaatccgtcag
ctctctcagtctcttcttcctgccatagtggagctggctgaagatgccaaatggagggtc
cggctggccatcattgagtatatgccactgctggcaggtcagctgggtgtggaattcttt
gatgaaaagctgaattcgttatgtatggcctggctcgtggaccatgtgtatgccattcgt
gaagctgccaccaacaacctcatgaaactagttcagaagtttggtatagagtgggcccaa
agtgccattgttcccaaagtgttagtaatggcaaatgatcctaattatttgcacagaatg
accactttattctgcattaatgcactgtctgaagcctgtggtcaggaaataaccactaag
cagatgctgcctatcgtactgaaaatggcaggggaccaagtagcaaatgttcgtttcaac
gtggccaaatctctacagaaaatcggaccaattctagatattgatgctttgcaggaggaa
gttaagccagtactacagaagttaggccaagatgaagacatggatgtcaaatacttcgca
caggaagctataagtgtggtggcccaaaggctgaggaagctagattttcctgtgaaggac
agtgaagagcccagtgcccctggggctgacaagaaccatttcctgagacccagagggcct
ggagaggacaccaggaagggaccagcatatcagttgcacgtaaacgctagagacacactt
gcccaactggaaattgcagaactagtgcatttttcccagagcagagagtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521366
Entry
107521366         CDS       T06036                                 

Gene name
PPP2R5C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04728  Dopaminergic synapse
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107521366 (PPP2R5C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107521366 (PPP2R5C)
   04151 PI3K-Akt signaling pathway
    107521366 (PPP2R5C)
   04152 AMPK signaling pathway
    107521366 (PPP2R5C)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107521366 (PPP2R5C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107521366 (PPP2R5C)
  09156 Nervous system
   04728 Dopaminergic synapse
    107521366 (PPP2R5C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107521366 (PPP2R5C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107521366 (PPP2R5C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107521366 (PPP2R5C)
   03036 Chromosome and associated proteins [BR:ray03036]
    107521366 (PPP2R5C)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107521366 (PPP2R5C)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107521366 (PPP2R5C)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107521366 (PPP2R5C)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 107521366
NCBI-ProteinID: XP_016021466
LinkDB
Position
Unknown
AA seq 578 aa
MPNKNKKEKDLPKAGKSGKSSKDGQDVLEPEIPSKKNSLITAPSTSSSKIKVPLSQPTVK
KEKRQNSSRFSITSNRELQKLSSLKDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWK
EVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPT
LEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTL
HRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIF
LLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPKEVMFLN
ELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKI
LPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKER
EEAWVKIENLAKANPQYAVYSQASTVSIPVAMETDGPLFEDVLMLRKTVNEEARQAQKDL
KKDRPLIRRKSELPQEPHTKNALEARCRADPLLPQDGR
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgccgaataaaaacaagaaggagaaagatttacccaaagcagggaaaagtggaaaaagt
tccaaagacggacaagacgtattagaacccgagattcccagcaagaaaaacagccttatt
actgccccgtccacatcatccagtaaaataaaagtgccactctctcagcccacggtgaag
aaagaaaaacggcagaattcctccagatttagcatcaccagtaacagagagcttcaaaaa
ctgtcgtctttgaaagatgttcctcctgccgatcaagagaagctcttcatccagaagtta
cgtcagtgttgtgtcctctttgactttgtttccgacccactcagcgacctaaagtggaag
gaagtgaagcgagctgctttgagtgagatggtagagtacatcacccataatcggaacgtg
atcacagagccgatctacccggaagtagtgcacatgtttgcagttaacatgttccgaacg
ttaccgccttcctccaaccctacgggagcagagttcgacccagaggaagacgagccaacg
ttagaagccgcctggcctcacctgcagcttgtttatgaatttttcttaagatttttagag
tctccagatttccaacctaatatagcgaagaaatatatcgaccagaaatttgtattgcag
cttttagagctctttgacagcgaagatccccgagagagagattttcttaaaacgaccctt
cacagaatctatgggaaattcttaggcttaagagcttacatcagaaaacagataaataat
atattttataggtttatttatgaaacagagcatcacaatggcatagcagagttactggag
atactgggaagcataatcaacgggtttgccttaccgctgaaagaagagcacaagatcttc
ttactgaaggtgttgctgcctctgcacaaagtgaagtccctgagcgtctaccacccccag
ctggcatactgtgtagtccagtttctagaaaaggacagcaccctcaccgaaccggtggtg
atggcacttctcaaatactggccaaagactcacagtccaaaggaagtgatgttcctgaac
gagctggaggagatcctggacgtgatcgagccgtcggagttcgtcaagatcatggagccg
ctcttccggcagctggccaagtgtgtctccagcccccacttccaggtggcggagcgggcc
ctgtactactggaacaacgagtacatcatgagcctgatcagcgacaacgcggccaagatc
ctgcccatcatgttcccgtccttgtaccgcaactcgaagacccactggaacaagacaatc
catggcttgatatacaacgcgctgaaactgttcatggagatgaaccagaagctgtttgac
gactgcacccagcagttcaaagcggagaagctgaaagagaagctaaaaatgaaagaacgt
gaagaagcgtgggttaaaatagagaatctagccaaagcaaacccccagtacgcagtgtat
agtcaagcgagcaccgtgagcatcccggttgcaatggagacagatgggcccttgtttgaa
gatgtgctgatgctgagaaagacagtgaacgaagaggctcgccaggcacagaaggacctg
aagaaggaccggcccctgatccgccgcaagtccgagctgcctcaggagccccacaccaag
aacgccttggaggctcgctgcagagccgacccgctgctgccccaggacggccgctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521621
Entry
107521621         CDS       T06036                                 

Gene name
PPP2R5A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04728  Dopaminergic synapse
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107521621 (PPP2R5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107521621 (PPP2R5A)
   04151 PI3K-Akt signaling pathway
    107521621 (PPP2R5A)
   04152 AMPK signaling pathway
    107521621 (PPP2R5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107521621 (PPP2R5A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107521621 (PPP2R5A)
  09156 Nervous system
   04728 Dopaminergic synapse
    107521621 (PPP2R5A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107521621 (PPP2R5A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107521621 (PPP2R5A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107521621 (PPP2R5A)
   03036 Chromosome and associated proteins [BR:ray03036]
    107521621 (PPP2R5A)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107521621 (PPP2R5A)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107521621 (PPP2R5A)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107521621 (PPP2R5A)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 107521621
NCBI-ProteinID: XP_016021947
LinkDB
Position
Unknown
AA seq 485 aa
MSSSSPPGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLKD
ATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAYS
DIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIAK
RYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYETE
HFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFLE
KDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKSVS
SSHFQVAERALYFWNNEYILSLIEENIDKILPIMFGSLYKISKEHWNQTIVALVYNVLKT
LMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSILS
NTSNE
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcgtcgccgccgggggctgccagcgccgccatctcggcctcggagaaagtg
gacggcttcacccggaaatcggtgcgcaaggcgcagaggcagaagcgctcccagggctcg
tcgcagttccgcagccagggcagccaggcggagctgcaccccttgccccagctcaaagat
gccacttcaaatgaacaacaagagctcttctgtcagaagttgcagcagtgttgtatactg
tttgatttcatggactctgtttcagacttgaagagcaaagaaattaaaagagcaacactg
aacgaactggttgagtatgtttcaactaatcgtggtgtaattgtcgaatcagcgtattct
gatatagtaaaaatgataagtgctaacatcttccgtactcttcctccaagcgataatcca
gattttgatccggaagaagatgaacccacacttgaggcttcttggcctcacatacaattg
gtgtatgaattcttcttaagatttttggagagccctgatttccagcctagcattgcaaaa
cgatacattgatcagaaatttgtacaacagctcctggagctttttgatagtgaagatccc
agagaacgtgactttctgaagactgttcttcatcgaatttatgggaaatttcttggatta
agagcattcatcagaaaacaaattaacaacattttcctcaggtttatatatgaaacagaa
catttcaatggtgttgctgaactccttgaaatattaggaagtattatcaatggctttgca
ttgccactgaaagcagaacataaacaatttctaatgaaggttcttattcccatgcatact
gcaaaaggattagctttgtttcatgctcagctagcctactgtgttgtacagttcctggag
aaagatacaacgctaacggaaccagtgatcagaggattgctgaaattttggccaaaaacg
tgcagtcagaaagaggtgatgtttttaggagaaattgaagaaatcttagatgtcatcgaa
ccaacacagttcaaaaaaattgaagagcccctttttaagcagatatccaagagtgtatcc
agttctcattttcaggttgcagaaagggcattgtacttctggaataatgaatatattctt
agtttgattgaggagaatatcgataaaattctgccaatcatgtttggtagtttgtacaaa
atctccaaagaacactggaatcagaccattgtagcactggtctacaatgtgctgaaaacc
ttaatggaaatgaatggcaagctttttgatgaccttactagctcgtacaaagctgaaaga
caaagagagaaaaagaaggaattggaacgtgaagaattatggaaaaaattagaggagcta
aagctaaagaaagctctagaaaaacagaacagtgcttacaacatgcacagtattctcagc
aatacaagtaacgaataa

DBGET integrated database retrieval system