KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500417
Entry
107500417         CDS       T06036                                 

Gene name
PPP2R1A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04350  TGF-beta signaling pathway
ray04390  Hippo signaling pathway
ray04530  Tight junction
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray05142  Chagas disease
ray05160  Hepatitis C
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107500417 (PPP2R1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107500417 (PPP2R1A)
   04390 Hippo signaling pathway
    107500417 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    107500417 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    107500417 (PPP2R1A)
   04152 AMPK signaling pathway
    107500417 (PPP2R1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107500417 (PPP2R1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107500417 (PPP2R1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107500417 (PPP2R1A)
  09156 Nervous system
   04728 Dopaminergic synapse
    107500417 (PPP2R1A)
   04730 Long-term depression
    107500417 (PPP2R1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107500417 (PPP2R1A)
   05165 Human papillomavirus infection
    107500417 (PPP2R1A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107500417 (PPP2R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107500417 (PPP2R1A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107500417 (PPP2R1A)
   03036 Chromosome and associated proteins [BR:ray03036]
    107500417 (PPP2R1A)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107500417 (PPP2R1A)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107500417 (PPP2R1A)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107500417 (PPP2R1A)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L Spore_Cse60
Other DBs
NCBI-GeneID: 107500417
NCBI-ProteinID: XP_015981093
LinkDB
Position
Unknown
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcggccgctgacggtgacgactcgctctatcccatcgcggtgctcatagacgagctc
cgcaacgaggatgtgcagctccgcctcaacagcatcaagaagctgtccaccatcgccttg
gccctcggggtggagaggacccgcagcgagcttctgcccttcttgacagacaccatctac
gatgaggatgaggtcctcctggcgctggcggagcagctgggaaccttcaccaccctggtg
ggaggccccgagtacgtgcactgcctgctgccacccctggagtcactggccacagtggag
gagacggtggtgcgggacaaggcggtggagtccttgcgggccatctcgcacgagcactca
ccctctgacctggaggcccacttcgtgccgctggtgaagcggctggcgggcggcgactgg
ttcacctcccgcacctcggcctgcggcctcttctccgtctgctacccccgcgtgtccagc
gccgtcaaggccgagctccgacagtacttccggaacctgtgctcagatgacacccccatg
gtgcggcgggccgcagcttctaagctgggggagttcgccaaggtgctggagctggacaac
gtcaagagcgagatcatccctatgttctccaacctggcctctgacgagcaggactcggtg
cggctgctggcagtggaggcatgcgtgaacatcgctcagctgctgcctcaggaggacctg
gaggccctggtgatgcccaccctgcgccaggccgccgaagacaagtcgtggcgcgtgcgg
tacatggtggccgacaagttcacagagctccagaaagccgtggggcctgagatcaccaag
acggacctggtccccgccttccagaacctgatgaaagactgtgaggccgaggtgagggcc
gcagcctctcacaaggtcaaagaattctgtgaaaatctctctgccgactgccgggagaac
gtgatcatgacccagatcctgccgtgcatcaaggagctggtgtcagacgccaaccagcac
gtcaagtcggcactggcttcggtcattatgggcctctccccaatcctgggcaaggacaac
accattgagcacctcttgcccctcttcctggctcagctgaaggacgagtgcccggaggtg
cggctgaacatcatctccaacctggactgcgtcaacgaggtgatcggcatccggcagctg
tcccagtcgctgctccccgccatcgtggagctggcggaggatgccaagtggcgagtgcgg
ctggccatcatcgagtacatgcccctgctggctgggcagctgggggtggagttctttgac
gagaagctcaactccttgtgcatggcctggcttgtggatcatgtctatgccatccgcgag
gcagccaccagcaacctgaagaagctggtggagaagttcgggaaggagtgggcccacgcc
actattatccccaaggtcttggccatgtctggggaccccaactacttgcaccgcatgaca
acactcttctgcatcaatgtgctgtctgaggtctgcgggcaggacatcaccactaagcac
atgctgcccacggtcctgcgtatggcgggggaccccgttgccaacgtccgcttcaacgtg
gccaagtccctgcagaagataggtcccatcctggacaacagcacgctgcagagcgaggtc
aagcccatcctggagaagctgacgcaggaccaggacgtggacgtcaagtactttgcccag
gaggccctgactgtgctttctctcgcatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505807
Entry
107505807         CDS       T06036                                 

Gene name
PPP2CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04136  Autophagy - other
ray04140  Autophagy - animal
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04350  TGF-beta signaling pathway
ray04390  Hippo signaling pathway
ray04530  Tight junction
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray05142  Chagas disease
ray05160  Hepatitis C
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107505807 (PPP2CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107505807 (PPP2CB)
   04390 Hippo signaling pathway
    107505807 (PPP2CB)
   04071 Sphingolipid signaling pathway
    107505807 (PPP2CB)
   04151 PI3K-Akt signaling pathway
    107505807 (PPP2CB)
   04152 AMPK signaling pathway
    107505807 (PPP2CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107505807 (PPP2CB)
   04136 Autophagy - other
    107505807 (PPP2CB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107505807 (PPP2CB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107505807 (PPP2CB)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107505807 (PPP2CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    107505807 (PPP2CB)
   04730 Long-term depression
    107505807 (PPP2CB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107505807 (PPP2CB)
   05165 Human papillomavirus infection
    107505807 (PPP2CB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107505807 (PPP2CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107505807 (PPP2CB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107505807 (PPP2CB)
   04131 Membrane trafficking [BR:ray04131]
    107505807 (PPP2CB)
   03036 Chromosome and associated proteins [BR:ray03036]
    107505807 (PPP2CB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107505807 (PPP2CB)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107505807 (PPP2CB)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     107505807 (PPP2CB)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107505807 (PPP2CB)
Membrane trafficking [BR:ray04131]
 Autophagy
  Other autophagy associated proteins
   Others
    107505807 (PPP2CB)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107505807 (PPP2CB)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107505807 (PPP2CB)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N
Other DBs
NCBI-GeneID: 107505807
NCBI-ProteinID: XP_015991635
LinkDB
Position
Unknown
AA seq 309 aa
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgacaaggcgttcaccaaggagctggaccagtgggtcgagcagctgaacgagtgt
aaacagctgaacgagaaccaagtgcggacgctgtgcgaaaaggctaaagaaattttaaca
aaagaatcaaatgtgcaagaggttcgctgtcctgttaccgtctgtggagatgtgcacggt
caattccatgatcttatggaactctttagaattggaggaaaatcaccagatacaaactat
ctattcatgggtgactatgtagacagaggttattattcagtggagactgtgactcttctt
gtggcattaaaggtgcgttatccagaacgcattacaatattgagaggaaaccatgaaagc
cgacaaattacccaagtatatggcttttatgatgaatgtctacggaagtatggaaatgcc
aatgtttggaaatattttacagatctatttgattatcttcctcttacagctttagtagat
ggacagatattttgcctccatggtggcctctctccgtccatagatacactggatcatata
agagccctggatcgtttgcaggaagttccacatgagggcccaatgtgtgatctgttatgg
tcagatccagatgatcgtggcgggtggggtatttcaccacgcggtgctggctacacattt
ggacaagacatttctgaaacatttaaccacgccaatggtctcacactggtttctcgtgct
caccaacttgtaatggagggatacaattggtgtcatgatcggaatgtggtgaccattttc
agtgcacccaattactgttatcgttgtgggaaccaggctgctatcatggaattagatgac
actttaaaatattccttccttcagtttgacccagcacctcgtcgtggagagcctcatgtt
acccggcgcaccccagactacttcctgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506800
Entry
107506800         CDS       T06036                                 

Gene name
PPP2CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04136  Autophagy - other
ray04140  Autophagy - animal
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04350  TGF-beta signaling pathway
ray04390  Hippo signaling pathway
ray04530  Tight junction
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray05142  Chagas disease
ray05160  Hepatitis C
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107506800 (PPP2CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107506800 (PPP2CA)
   04390 Hippo signaling pathway
    107506800 (PPP2CA)
   04071 Sphingolipid signaling pathway
    107506800 (PPP2CA)
   04151 PI3K-Akt signaling pathway
    107506800 (PPP2CA)
   04152 AMPK signaling pathway
    107506800 (PPP2CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107506800 (PPP2CA)
   04136 Autophagy - other
    107506800 (PPP2CA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    107506800 (PPP2CA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107506800 (PPP2CA)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107506800 (PPP2CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    107506800 (PPP2CA)
   04730 Long-term depression
    107506800 (PPP2CA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107506800 (PPP2CA)
   05165 Human papillomavirus infection
    107506800 (PPP2CA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107506800 (PPP2CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107506800 (PPP2CA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107506800 (PPP2CA)
   04131 Membrane trafficking [BR:ray04131]
    107506800 (PPP2CA)
   03036 Chromosome and associated proteins [BR:ray03036]
    107506800 (PPP2CA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107506800 (PPP2CA)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     107506800 (PPP2CA)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     107506800 (PPP2CA)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107506800 (PPP2CA)
Membrane trafficking [BR:ray04131]
 Autophagy
  Other autophagy associated proteins
   Others
    107506800 (PPP2CA)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107506800 (PPP2CA)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   107506800 (PPP2CA)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N YqzH
Other DBs
NCBI-GeneID: 107506800
NCBI-ProteinID: XP_015993143
LinkDB
Position
Unknown
AA seq 309 aa
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaaggtgttcaccaaggagctagaccagtggatcgagcagctgaacgagtgc
aagcagctctccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgtgcaagaggttcgatgtccagtcactgtctgtggagatgtgcatggg
caatttcatgatctcatggaactgtttagaattggtggcaaatcaccagatacaaattac
ttgtttatgggagattatgttgacagaggatattattccgttgaaacagttactctgctt
gtagcccttaaggttcgttaccgtgaacgtatcaccattctccgaggaaatcatgagagc
agacagattacacaagtatatggtttctatgatgagtgcttaaggaaatatggaaatgca
aatgtttggaaatattttacagatctttttgattatcttcctctcactgctttggtggac
ggtcagatcttctgtctacacggtggcctctcaccatccatagatacactggatcacatc
agagcgcttgatcgcctacaagaagttccccatgagggtccaatgtgtgacttgctgtgg
tcagatccagatgaccgtggtggttggggtatatctcctcgaggagctggttacaccttt
ggacaagatatttctgagacatttaatcatgccaatggcctcacactggtgtctagagct
caccagctggtgatggagggatataactggtgccatgaccggaatgtagtaacgattttc
agtgctccaaactattgttatcgttgtggtaaccaagctgcaatcatggaacttgatgat
actctaaaatactctttcttgcagtttgacccagcacctcgtagaggcgagccacatgtt
actcgtcgtaccccagactacttcctgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521184
Entry
107521184         CDS       T06036                                 

Gene name
PPP2R1B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform isoform X1
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04350  TGF-beta signaling pathway
ray04390  Hippo signaling pathway
ray04530  Tight junction
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray05142  Chagas disease
ray05160  Hepatitis C
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107521184 (PPP2R1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107521184 (PPP2R1B)
   04390 Hippo signaling pathway
    107521184 (PPP2R1B)
   04071 Sphingolipid signaling pathway
    107521184 (PPP2R1B)
   04151 PI3K-Akt signaling pathway
    107521184 (PPP2R1B)
   04152 AMPK signaling pathway
    107521184 (PPP2R1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107521184 (PPP2R1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107521184 (PPP2R1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107521184 (PPP2R1B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107521184 (PPP2R1B)
   04730 Long-term depression
    107521184 (PPP2R1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    107521184 (PPP2R1B)
   05165 Human papillomavirus infection
    107521184 (PPP2R1B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107521184 (PPP2R1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107521184 (PPP2R1B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107521184 (PPP2R1B)
   03036 Chromosome and associated proteins [BR:ray03036]
    107521184 (PPP2R1B)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107521184 (PPP2R1B)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107521184 (PPP2R1B)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107521184 (PPP2R1B)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N M11L CLASP_N IFRD AEP1 DUF3730
Other DBs
NCBI-GeneID: 107521184
NCBI-ProteinID: XP_016021135
LinkDB
Position
Unknown
AA seq 476 aa
MVRRAAASKLGEFAKVLELDSVKSEIVPLFTNLASDEQDSVRLLAVEACVSIAQLLSQDD
LEILVMPTLRQAAEDKSWRVRYMVADKFSELQKAVGPKITLNDLIPAFQNLLKDCEAEVR
AAAAHKVKELCENLPIEGRETIIMNQILPYIKELVSDTNQHVKSALASVIMGLSTILGKE
NTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRV
RLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMKLVQKFGIEWAQ
SAIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKMAGDQVANVRFN
VAKSLQKIGPILDIDALQEEVKPVLQKLGQDEDMDVKYFAQEAISVVAQRLRKLDFPVKD
SEEPSAPGADKNHFLRPRGPGEDTRKGPAYQLHVNARDTLAQLEIAELVHFSQSRE
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggtacgtcgtgctgctgcttccaaattgggcgaatttgcaaaagttttagagttagac
agtgtgaaaagcgaaattgttccattgttcactaatctagcttcagatgaacaggattcg
gtgcgcctcttagctgtagaagcttgtgtcagtattgctcagctactgtctcaggacgac
cttgagattctggtgatgcctacacttcgacaagcagcggaagataaatcttggcgagtt
cgctatatggtagctgacaaattttcagagcttcagaaagctgtgggtcctaaaatcacg
ctaaacgacctcatccccgcctttcagaacctacttaaagactgtgaagctgaagtccga
gcagctgctgcccacaaagtaaaagaactttgtgagaacttgcccattgaaggtagagag
accataattatgaatcaaattctgccctatattaaggaattagtatctgatacaaatcaa
catgtcaaatcagctctagcttctgtaattatgggattgtctaccattttgggcaaagag
aataccattgaacatcttctacctctttttttagctcagttaaaggatgagtgtcctgaa
gttcgtctcaatatcatctccaatttggattgtgtaaatgaagtaattggaatccgtcag
ctctctcagtctcttcttcctgccatagtggagctggctgaagatgccaaatggagggtc
cggctggccatcattgagtatatgccactgctggcaggtcagctgggtgtggaattcttt
gatgaaaagctgaattcgttatgtatggcctggctcgtggaccatgtgtatgccattcgt
gaagctgccaccaacaacctcatgaaactagttcagaagtttggtatagagtgggcccaa
agtgccattgttcccaaagtgttagtaatggcaaatgatcctaattatttgcacagaatg
accactttattctgcattaatgcactgtctgaagcctgtggtcaggaaataaccactaag
cagatgctgcctatcgtactgaaaatggcaggggaccaagtagcaaatgttcgtttcaac
gtggccaaatctctacagaaaatcggaccaattctagatattgatgctttgcaggaggaa
gttaagccagtactacagaagttaggccaagatgaagacatggatgtcaaatacttcgca
caggaagctataagtgtggtggcccaaaggctgaggaagctagattttcctgtgaaggac
agtgaagagcccagtgcccctggggctgacaagaaccatttcctgagacccagagggcct
ggagaggacaccaggaagggaccagcatatcagttgcacgtaaacgctagagacacactt
gcccaactggaaattgcagaactagtgcatttttcccagagcagagagtaa

DBGET integrated database retrieval system