KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500447
Entry
107500447         CDS       T06036                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist isoform X1
  KO
K04726  BH3 interacting domain death agonist
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01524  Platinum drug resistance
ray04071  Sphingolipid signaling pathway
ray04115  p53 signaling pathway
ray04210  Apoptosis
ray04215  Apoptosis - multiple species
ray04217  Necroptosis
ray04650  Natural killer cell mediated cytotoxicity
ray04932  Non-alcoholic fatty liver disease
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05022  Pathways of neurodegeneration - multiple diseases
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107500447 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107500447 (BID)
   04215 Apoptosis - multiple species
    107500447 (BID)
   04217 Necroptosis
    107500447 (BID)
   04115 p53 signaling pathway
    107500447 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107500447 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107500447 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107500447 (BID)
   05014 Amyotrophic lateral sclerosis
    107500447 (BID)
   05022 Pathways of neurodegeneration - multiple diseases
    107500447 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107500447 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107500447 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107500447 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107500447 (BID)
   05161 Hepatitis B
    107500447 (BID)
   05160 Hepatitis C
    107500447 (BID)
   05164 Influenza A
    107500447 (BID)
   05162 Measles
    107500447 (BID)
   05168 Herpes simplex virus 1 infection
    107500447 (BID)
   05163 Human cytomegalovirus infection
    107500447 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107500447 (BID)
   05169 Epstein-Barr virus infection
    107500447 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107500447 (BID)
SSDB
Motif
Pfam: BID
Other DBs
NCBI-GeneID: 107500447
NCBI-ProteinID: XP_015981191
LinkDB
Position
Unknown
AA seq 229 aa
MLPSRLLPWTPASQKLVELPAACAMDPKVSNGACLQQEHITDLLVFGFLQNCCSSNFHQE
LQALGHELPVPACLREDDDDELQTDGSRCSRIVRGSDETESESQEEIIQNIARQLAQIGD
RMDSSIPSRVVNNLAMEFMNVNLSEEDRKDCLSAALEVVMETYPKDMEKEKTMLMLTMLL
AKKVADHTPSLLRGVFHTTVNFINQNLLTYVRNLVRNVRTSDVSSSASH
NT seq 690 nt   +upstreamnt  +downstreamnt
atgttgcccagcaggctgctgccttggacacctgcaagccagaagctagtcgagctgcca
gctgcctgtgccatggatcccaaggtcagcaacggtgcatgccttcagcaagagcacatc
acagacctgctggtgtttggcttcctccaaaactgctgcagctccaatttccaccaagag
ctgcaggcgctgggccacgagctgcctgtgccagcctgcctgcgggaagacgatgacgac
gaactgcagacggatggcagccggtgcagccgcatcgtccggggaagcgacgagacagag
tctgagagtcaagaggaaatcatccagaatatcgccaggcaactcgcccaaataggggac
aggatggactccagcatcccctcaagagtggtgaataacctggcaatggaatttatgaat
gtgaacctgtcagaggaagacaggaaggattgcctctctgctgcactggaggtggtcatg
gagacttatcctaaagacatggagaaggagaagaccatgctgatgctgaccatgctgttg
gccaaaaaggtggccgatcacacaccgtccttgctccgtggtgtctttcacacaacagtg
aattttattaaccagaacctgctcacctatgtgagaaacttagtgagaaatgtaagaacc
agtgatgtcagctcctcggcatctcactga

DBGET integrated database retrieval system