KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500527
Entry
107500527         CDS       T06036                                 

Gene name
CHRNA3
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-3
  KO
K04805  nicotinic acetylcholine receptor alpha-3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107500527 (CHRNA3)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107500527 (CHRNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107500527 (CHRNA3)
Ion channels [BR:ray04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107500527 (CHRNA3)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD FtsK_alpha
Other DBs
NCBI-GeneID: 107500527
NCBI-ProteinID: XP_015981351
LinkDB
Position
Unknown
AA seq 503 aa
MGAHPLRALPLLRLLQLLLLIMKTPVASGSEAEHRLFERLFEDYNEIIRPVANVSDPVII
QFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYDGAEFMRVPAQKIWKPDIV
LYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSY
DKAKIDLVLIGSSVNLKDYWESGEWAIIRAPGYKHDIKYNCCEEIYPDITYSLYIRRLPL
FYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIP
LIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKTIFLNLLPRIMFMTRPASS
EGNGQRPRPLHIAELANLNCFSHTEPKGCKEGHPCQDGTCGHCHHRRLKISNFSANLTRS
SSSESVDAVLSLSTLSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRIFLWV
FILVCILGTAGLFLQPLMARDDA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgggtgcacacccactccgggcgctgccacttctgcggctgctgcagctgctgctgctg
ataatgaagacgccagtggccagcggctccgaggctgagcaccgtctgtttgagcggctg
tttgaagattacaacgagatcatccggcctgtggccaacgtgtctgaccccgtcatcatc
cagtttgaggtgtccatgtctcagctggtgaaggtggacgaagtaaaccagatcatggag
accaacctgtggctcaagcaaatctggaacgactacaagctgaaatggaacccctccgac
tatgacggggcagagtttatgcgtgtccctgcccagaagatctggaagccagacatcgtg
ctatacaacaatgccgttggcgatttccaagtggacgacaagaccaaagcactgctcaag
tacacgggggaagtgacctggatccctccagccatcttcaagagttcgtgcaaaatcgac
gtgacctacttcccgttcgattaccagaactgcaccatgaagttcgggtcctggtcctac
gacaaggcaaagattgacctggtgctcatcggctcctccgtgaacctcaaggactactgg
gagagcggcgagtgggccatcatccgagccccgggctacaagcacgacatcaagtacaac
tgctgcgaggagatataccccgacatcacgtactcactgtacatccggcgcctgccgctc
ttctacaccatcaacctcatcatcccctgcctgctcatctctttcctcactgtgctcgtc
ttctacctgccgtccgactgcggtgagaaggtgaccctctgcatctcggtcctcctgtcc
ctgactgtcttcctcctggtcattaccgagaccatcccgtccacctcactggtcatcccc
ctgattggcgagtacctcctgttcaccatgatttttgtcaccttgtccatcgtcatcacc
gtctttgttctcaacgtgcactacagaaccccgaccactcacacgatgcccacatgggtg
aagaccatattcttgaacttgcttcctaggatcatgttcatgaccaggccagccagcagt
gagggcaacggtcagaggccaagacccctccacattgctgagcttgccaacctgaactgc
ttcagccacacggagcccaaaggctgcaaggagggccacccctgccaagacgggacgtgt
ggccactgccaccaccgcaggttgaaaatctcaaacttcagtgccaacctcacgagaagt
tccagttccgaatctgtcgacgccgtgctgtccctctctactctgtcaccggaaatcaag
gaagccatccaaagtgtcaagtatattgctgaaaacatgaaagcacaaaatgaagccaaa
gagattcaagatgactggaagtatgttgccatggtgattgaccgtatctttctgtgggtt
ttcatcctggtgtgcattttagggacagctggattgtttctgcagcccctgatggccagg
gatgatgcataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500529
Entry
107500529         CDS       T06036                                 

Gene name
CHRNB4
Definition
(RefSeq) neuronal acetylcholine receptor subunit beta-4
  KO
K04815  nicotinic acetylcholine receptor beta-4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107500529 (CHRNB4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107500529 (CHRNB4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107500529 (CHRNB4)
Ion channels [BR:ray04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107500529 (CHRNB4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 107500529
NCBI-ProteinID: XP_015981352
LinkDB
Position
Unknown
AA seq 490 aa
MRSAHPLVLFSLAALCGSGDCRVANAEEKLMDHLLNKTRYNNLIRPATSSLQLISIQLQL
SLAQLISVNEREQIMTTNVWLKQEWTDYRLAWNSSCYEGVNILRIPAKRIWLPDIVLYNN
ADGTYEVSLYTNVVVRSNGSIMWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTE
IDMVLKSPTASMDDFTPSGEWDIVALPGRRTVNPKDPSYVDVTYDFIIRRKPLFYTINLI
IPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLM
FTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVRRCFLRQLPTFLFMKRPDGSSPRTPQP
SQAEAPATASAPGPAGSSNLCGTSTYFVNPASAAPKPPTGSDSVRTPRDFRPRSSGRFQQ
DVQEALQGVSFIAQHMKSDDQDQSVVEDWKYVAMVVDRLFLWVFVVVCVLGTVGLFLPPV
FQTHVPSEGP
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgaggagcgcgcaccccctggtcctcttctccctggctgccctttgcgggagcggggac
tgccgtgtggccaatgccgaggagaagctcatggatcaccttctgaacaaaacccgctac
aacaacttgattcgcccggccaccagctccttgcagctcatctccatccagctgcagctg
tccctggcccagctcattagtgtgaatgagcgagaacagatcatgaccaccaatgtctgg
ctgaaacaggagtggaccgactaccgcctggcctggaacagctcctgctacgagggtgtg
aacatcctgaggatccctgcaaagcgcatctggctgcctgacatcgtgctttacaacaat
gccgacgggacctacgaggtgtctctctacaccaacgtggtggtgcgctccaacggcagc
atcatgtggctgccccccgccatctacaagagcgcctgcaagatcgaggtgaagcacttc
ccctttgaccagcaaaactgcaccctcaagttccgctcctggacctacgaccacacggag
attgacatggtcctcaagtcgcccacggccagcatggatgacttcacccccagtggtgaa
tgggacatcgtggccctcccggggcgaaggacggtgaacccgaaggacccgagctacgtg
gacgtgacgtacgacttcatcatccgccgcaagccgctgttctataccatcaacctcatc
atcccctgtgttctcatcacctcgctggccatcctggtcttctacctgccgtccgactgc
ggcgagaagatgacgctgtgcatctccgtgctgctggctctcaccgtcttcctgctgctc
atctccaagatcgtgccgcccacctccctggacgtgccgctcattggcaagtacctcatg
ttcaccatggtgctggtcaccttctccattgtcaccagtgtgtgcgtgctcaacgtgcac
caccgctcgcccagcacgcacaccatggcgccctgggtcaggcgctgcttcctgcgccag
ctgcccaccttcctcttcatgaagcgccccgacggcagttcccccaggactccccagccc
agccaggctgaggcccccgccaccgcctcggccccgggcccagccggctcctccaacctc
tgcgggacctccacgtacttcgtgaatcctgcctctgcagctcccaagcctcccactggc
tctgactctgtgaggacccccagggacttccggccgaggtcctccgggaggtttcagcag
gatgtgcaggaggctttacagggcgtcagcttcatcgcccagcacatgaagagtgacgat
caggaccagagcgttgtggaggactggaagtacgtggccatggtggtcgatcggctgttc
ctgtgggtgttcgtggttgtgtgtgtgctgggcaccgtggggctcttcctgcctcccgtc
ttccagacccacgtgccctccgagggtccctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501325
Entry
107501325         CDS       T06036                                 

Gene name
CHRNA6
Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-6
  KO
K04808  nicotinic acetylcholine receptor alpha-6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04725  Cholinergic synapse
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107501325 (CHRNA6)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107501325 (CHRNA6)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    107501325 (CHRNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107501325 (CHRNA6)
Ion channels [BR:ray04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107501325 (CHRNA6)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Other DBs
NCBI-GeneID: 107501325
NCBI-ProteinID: XP_015982850
LinkDB
Position
Unknown
AA seq 494 aa
MLTSKGQGCLHFDLCLCLCILLSFFKACAACASEERLFHKLFSHYNQFIRPVENVSDPVT
VHFEVAITQLANVDEVNQIMETNLWLRHIWNDYKLRWDPVEYDGIETLRVPADKIWKPDI
VLYNNAVGDFQVEGKTKALLKYNGMITWSPPAIFKSSCPMDITFFPFDHQNCSLKFGSWT
YDKAEIDLLIIGSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLP
MFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVI
PLVGEYLLFTMIFVTLSIAVTVFVLNIHYRTPTTHTMPKWVKMVFLQLLPNILMMRRPLD
KTRKTSSDKNPKGTSSRLAKVKFDNRREPELLKECCPCHKSHQLATSKRRLSHQPLQWMT
ENSEHSPEVEDVINSVQFIAENMKNQNETKEVEDDWKYVAMVVDRVFLWIFIIVCVFGTA
GLFLQPLLGNTGKS
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgctgaccagcaagggtcagggatgccttcactttgatttgtgtctctgcttgtgtata
ctcctatctttctttaaagcctgtgcagcctgtgcgtctgaggagagactctttcacaaa
ctgttttctcattataaccaattcatcaggcctgtagaaaatgtttctgatcctgtcaca
gtgcattttgaagtggccatcacacagcttgccaatgtggatgaagtaaaccagatcatg
gaaaccaatttatggctacgtcatatctggaatgattataaattgcgttgggacccagtg
gaatacgatggcattgagacacttcgtgttcctgcagataagatctggaagccggacatt
gttctctataacaacgctgttggtgacttccaagtggaaggcaagacaaaagctcttctt
aaatacaatggcatgataacctggagtccaccagctatttttaagagttcctgccccatg
gatatcacttttttccctttcgatcatcaaaattgttccctaaaatttggttcctggaca
tatgacaaagccgaaattgatcttttaatcattggatctaaagtagatatgaatgatttt
tgggaaaacagtgagtgggaaattgttgatgcttctggctataaacacgacataaaatac
aactgttgcgaagagatatacacagatataacctattctttttacattagaaggttgccc
atgttttacaccattaatctgatcattccttgtctctttatttcatttctaactgtgttg
gtcttttaccttccttccgactgtggcgaaaaagtgacactttgcatttcagttctgctt
tctctgaccgtgtttttgctggtaatcacagaaaccatcccatccacgtcactcgtgatc
cccttggtgggtgagtacctactgtttaccatgatctttgtcaccctgtctatcgcggtg
actgtgtttgtgttaaacatacactatcgtacaccaacaacacacaccatgcccaagtgg
gtgaagatggttttcctccagctgttacccaacatcctaatgatgaggaggcctctggac
aagacaaggaagacaagttctgataaaaaccccaaaggcacttccagtaggcttgccaaa
gtcaagtttgataatcgcagagagcctgaacttcttaaagaatgctgtccctgtcataaa
tcacatcaacttgccaccagcaagaggagattaagtcatcagcctttacaatggatgaca
gaaaattcagagcattcacctgaagtcgaagatgtgattaatagtgttcaattcatagcc
gaaaacatgaagaaccaaaatgaaacaaaggaggtagaagacgactggaaatatgtagcc
atggtggtagacagagtgtttctttggatatttataattgtctgtgtgtttggaactgca
gggctatttctacagccgctgctggggaacacaggaaagtcttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504717
Entry
107504717         CDS       T06036                                 

Gene name
CHRNB2
Definition
(RefSeq) LOW QUALITY PROTEIN: neuronal acetylcholine receptor subunit beta-2
  KO
K04813  nicotinic acetylcholine receptor beta-2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04725  Cholinergic synapse
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107504717 (CHRNB2)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107504717 (CHRNB2)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    107504717 (CHRNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107504717 (CHRNB2)
Ion channels [BR:ray04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107504717 (CHRNB2)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Other DBs
NCBI-GeneID: 107504717
NCBI-ProteinID: XP_015989619
LinkDB
Position
Unknown
AA seq 502 aa
MAGRSGPTALLLGLGLLGLCAGVCGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSDVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFVIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRRHCARQR
LRQRRRRLERERGGRALVFRDAPADSCTCFVNRASVQGLAGAFGAEPAPXSGPGRPAGPC
GCGLREAVDGVRFIADHMRSEDEDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTVAMFLQ
PLFQNYTAATSLRADRAAPSSK
NT seq 1509 nt   +upstreamnt  +downstreamnt
atggccgggcgctccggccccacggcgctgctcctcggcctcggcctcctcggactgtgc
gcaggagtctgtggtacagacacagaggagcggctggtggagcatctcctggacccctcc
cgctacaacaagctcatccgcccagccaccaatggctctgagctggtgacagtacagctc
atggtatcactagcccagctcatcagtgtgcatgagcgggagcagatcatgaccaccaat
gtgtggctaacccaggagtgggaggattaccgtctcacttggaagcctgaggaatttgac
aacatgaagaaagttcgactcccttccaaacacatctggctcccagatgtggtcctgtac
aataatgctgacggcatgtacgaggtgtccttctactccaatgccgtggtgtcctatgac
ggcagcatcttctggctgcccccggccatctacaagagcgcgtgcaagatcgaagtgaag
cacttcccgttcgaccagcagaactgcaccatgaagttccgctcgtggacctacgaccgc
accgagatcgacctggtgctcaagagtgacgtggccagtctggacgacttcacgcccagc
ggcgagtgggacatcgtggcgctgcccggccggcgcaacgagaacccagacgactccacc
tacgtggacatcacctacgacttcgtcatccgccgcaagccgctgttctacaccatcaac
ctcatcatcccctgcgtgctcatcacctcgctggccatcctggtcttctacctgccgtcc
gactgcggcgagaagatgacgctgtgcatctctgtgctgctggcgctcaccgtcttcctg
ctgctcatctccaagatcgtgccgcccacgtcgctcgacgtgccgctcgtcggcaagtac
ctcatgttcaccatggtgctggtcaccttctccatcgtcaccagcgtgtgcgtgctcaac
gtgcaccaccgctcgcccaccacgcacaccatggcgccctgggtcaaggtcgtcttcctg
gagaagctgcccgcgctgctcttcatgcagcagccgcggcggcactgcgcgcgccagcgc
ctgcgccagcggcggcggcggctggagcgcgagcgcggcgggcgggcgctggtcttccgc
gacgccccggccgactcctgcacgtgcttcgtcaaccgcgcctcggtccagggcctggcg
ggggccttcggggcggagcccgcgcccngcagcggcccggggcgccccgcggggccgtgt
ggctgcggcctccgggaggccgtggacggcgtgcgcttcatcgcggaccacatgcggagc
gaggacgaggaccagagcgtgagcgaggactggaagtacgttgccatggtgatcgaccgc
ctgttcctttggatctttgtcttcgtctgtgtcttcggcaccgtcgccatgttcctgcag
cctctcttccagaactacaccgcggccacctcgctgcgtgcggaccgcgcggctcccagc
tccaagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505776
Entry
107505776         CDS       T06036                                 

Gene name
CHRNA4
Definition
(RefSeq) LOW QUALITY PROTEIN: neuronal acetylcholine receptor subunit alpha-4
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04725  Cholinergic synapse
ray05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107505776 (CHRNA4)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107505776 (CHRNA4)
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    107505776 (CHRNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107505776 (CHRNA4)
Ion channels [BR:ray04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107505776 (CHRNA4)
SSDB
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF1409
Other DBs
NCBI-GeneID: 107505776
NCBI-ProteinID: XP_015991580
LinkDB
Position
Unknown
AA seq 615 aa
MELGGPGAPPPPPLPLLLLLGAGLLPVSSHVETRAHAEERLLKKLFSGYNKWSRPVANIS
DVVLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPDEYENVTSIRIPSELIW
RPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKF
GSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEVYPDITYAFVI
RRLPLFYTVNLILPCLLISCLTVLVFYLPSECGEKVTLCISVLLALTVFLLLITEIIPST
SLVVPLIGEYLLFTMVFVTLSIIVTVFVLNVHHRSPRTHAMPAWVRRAFLDAAPRLLLMR
RPPVAKGSCRRLIESMHRPAGAPRCWPEPEAGGTXSPAPSLCGPMDEPAKPQPACPAPAG
RAPALQPSEVQAAGPPSPGPPRPPTGAQAPGLSKARSLSVQHMSSPAEAGEGAVRCRSRS
IQYCVPRDEADSQTAASPASPKAPPAELPPPDQASPCRCKCRKQPSAGPPNTVLKAHGTK
AAPQHLPLSPALARAVEGVQYIADHLKAEDKDFSVKEDWKYVAMVVDRIFLWVFIIVCLL
GTVGLFLPPWLAGMI
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggagctcgggggccccggggcgccgccaccgccgccgctgccgctgctgctgcttctg
ggcgccggcctcctgcccgtgagcagccacgtggagacccgggcccacgccgaggagcgg
ctgctgaagaagctgttctctggctacaacaagtggtcccggccggtggccaacatctcg
gatgtggtccttgtccactttggcctgtccatcgcacagctcattgacgtggacgagaag
aaccagatgatgaccacgaacgtgtgggtgaagcaggagtggcatgactacaagctgcgc
tgggacccagacgagtacgagaacgtcacctccatcagaatcccctcggagcttatctgg
cggccggacatcgtcctctacaacaatgcggacggggacttcgccgtcacccacctgacc
aaggcccacctcttccacgacgggcgggtgcagtggacgccccccgccatctacaagagc
tcctgcagcatcgacgtcaccttcttccccttcgaccagcagaactgcaccatgaaattc
gggtcctggacctacgacaaggccaagatcgacctggtgagcatgcacagccgcgtggac
cagctggacttctgggagagcggcgagtgggtcatcgtggacgccgtgggcacctacaac
acgcggaagtacgagtgctgcgccgaggtgtaccccgacatcacctacgccttcgtcatc
cggcgcctgccgctcttctacaccgtcaacctcatcctcccctgcctgctcatctcctgc
ctgaccgtgctggtcttctacctgccgtccgagtgcggcgagaaggtcacgctgtgcatc
tccgtgctgctggcgctcaccgtcttcctgctgctcatcaccgagatcatcccgtccacc
tcgctggtcgtcccgctcatcggcgagtacctgctcttcaccatggtctttgtcacgctg
tccatcattgtcacggtcttcgtgctcaacgtgcaccaccgctcgccgcgcacgcacgcc
atgcccgcctgggtgcgccgggccttcctggacgctgcgccgcgcctgctgctcatgcgg
cggccgcccgtggccaagggcagctgccggcggctcatcgagtccatgcacaggccggcc
ggcgccccgcgctgctggcccgagcccgaggcgggcgggaccnnctcgcccgccccgtcc
ctctgcggccctatggacgagccggcgaagccccagcccgcctgcccggcgcccgcaggc
cgggcccccgctctgcagccctcagaggtgcaggcggccggccccccctcacccggcccc
ccgcgcccgcccaccggcgcccaggccccggggctcagcaaggcccggtccctgagcgtc
cagcacatgtccagccctgcggaggcaggggagggcgctgtccgatgccggtctcggagc
atccagtactgtgttcctcgcgacgaggccgatagccagacggccgcctcccccgcttcc
ccgaaggcacccccagccgagctcccgcccccagaccaggcctccccgtgcagatgcaag
tgcaggaagcagccgtccgcggggcccccaaacactgtgctcaaagcccacggcaccaaa
gccgcaccccagcatctgcccctgtcaccggccttggcgcgggcggtcgagggcgtgcag
tacatcgcagaccacctgaaggcggaagacaaagacttctcggtgaaggaggactggaag
tacgtggccatggtcgtcgaccgcatcttcctctgggtgttcatcatcgtctgcctgctg
ggcaccgtgggcctcttcctgccgccctggctggccggcatgatctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515755
Entry
107515755         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: neuronal acetylcholine receptor subunit alpha-7-like
  KO
K04809  nicotinic acetylcholine receptor alpha-7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04725  Cholinergic synapse
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05033  Nicotine addiction
ray05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107515755
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107515755
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107515755
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    107515755
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107515755
   05022 Pathways of neurodegeneration - multiple diseases
    107515755
  09165 Substance dependence
   05033 Nicotine addiction
    107515755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107515755
Ion channels [BR:ray04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   107515755
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF2417
Other DBs
NCBI-GeneID: 107515755
NCBI-ProteinID: XP_016010356
LinkDB
Position
Unknown
AA seq 494 aa
MRRPLWLALAASLLHATRQGEFQRKLYRELVKNYNPLERPVANDTQPLTVYFSLSLLQIM
DVDEKNQVLTTNIWLQMYWTDHYLQWNVSEYPGVKTVRFPDSQIWKPDILLYNSADERFD
ATFHTNVLVNSSGHCQYLPPGIFKSSCSIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQ
EADTSGYITNGEWDLMGVPGKRSENFYECCQEPYPDVTFTVTIRRRTLYYGLNLLVPCVL
ISSLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMVI
VGLSVVVTVIVLQYHHHDPDGGKMPKWTRVVLLNWCAWFLRMKRPGEERVRPACQLARRR
GSLASVDLGAGPAPPAANGDLLYLGFRGLDAVRCGPAPDVGALCGRLACSXAARAGTGPD
GDPDLARILDEVRYLAARFRRQDESAARGSEWKFAACVVDRLCLMAFSVFTVLCTVGILM
SAPNFVDAVSKDFA
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgcgccgcccgctgtggctggcgctggccgcgtcgctgctgcacgcgacccggcaaggc
gagttccagaggaagctgtacagggagctggtcaagaactacaacccgctggagaggccg
gtggccaacgacacgcagccgctcaccgtctacttctcgctgagcctcctgcagatcatg
gacgtggatgagaagaatcaagttctaaccaccaacatttggctgcaaatgtactggaca
gaccactacctgcagtggaacgtgtcggagtacccgggcgtgaagaccgtgcgcttcccg
gacagccagatctggaagccggacatccttctctacaacagtgccgatgagagattcgac
gccaccttccacacgaacgtgctggtgaactcctccgggcattgccagtacctcccccca
ggcatcttcaagagctcctgctccatcgacgtgcgctggttccccttcgacgtgcagcac
tgcaagctcaagttcgggtcctggtcgtatggggggtggtcgctggacctgcagatgcag
gaggcggacaccagcggctacatcaccaacggcgagtgggacctcatgggggtccccggc
aagcggagcgagaatttctacgagtgctgccaggagccgtacccggacgtcaccttcacg
gtgaccatccgccgcaggacgctgtactacggcctcaacctgctcgtcccctgtgtgctc
atctcgtccctggccctgctggtcttcctgctgcccgcggactccggggagaagatctcc
ctcgggatcacggtgctgctgtccctcaccgtcttcatgctgctggtggctgagatcatg
cccgcgacgtccgactcggtgcccctgatcgcccagtacttcgccagcaccatggtcatc
gtgggcctgtccgtggtcgtcacggtcatcgtgctgcagtaccaccaccacgaccccgac
ggcggcaagatgcccaagtggaccagggtcgtcctgctgaactggtgcgcctggttcctg
cgcatgaagcggccgggcgaggagcgcgtgcggccggcctgccagctcgcgcggcgccgc
ggcagcctggccagcgtggacctgggcgcggggcccgcgccgcccgccgccaacggcgac
ctgctctacctgggcttccgcggcctggacgccgtgcgctgcggcccggcgcccgacgtg
ggcgcgctgtgcggccgcctggcctgctcgnncgccgcgcgcgcgggcacgggccccgac
ggcgacccggacctggcgcgcatcctggacgaggtgcgctacctggccgcgcgcttccgc
cgccaggacgagagcgcggcgcggggcagcgagtggaagttcgcggcgtgcgtggtggac
cgcctgtgcctcatggccttctccgtgttcaccgtgctctgcaccgtgggcatcctcatg
tccgcgcccaacttcgtggacgccgtgtccaaggacttcgcgtga

DBGET integrated database retrieval system