KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500535
Entry
107500535         CDS       T06036                                 

Gene name
CUL1
Definition
(RefSeq) cullin-1 isoform X1
  KO
K03347  cullin 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04141  Protein processing in endoplasmic reticulum
ray04310  Wnt signaling pathway
ray04340  Hedgehog signaling pathway
ray04350  TGF-beta signaling pathway
ray04710  Circadian rhythm
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107500535 (CUL1)
   04120 Ubiquitin mediated proteolysis
    107500535 (CUL1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107500535 (CUL1)
   04340 Hedgehog signaling pathway
    107500535 (CUL1)
   04350 TGF-beta signaling pathway
    107500535 (CUL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107500535 (CUL1)
   04114 Oocyte meiosis
    107500535 (CUL1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    107500535 (CUL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107500535 (CUL1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107500535 (CUL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107500535 (CUL1)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Cullin
     107500535 (CUL1)
SSDB
Motif
Pfam: Cullin Cullin_Nedd8
Other DBs
NCBI-GeneID: 107500535
NCBI-ProteinID: XP_015981366
LinkDB
Position
Unknown
AA seq 778 aa
MSSNRSQNPHGLKQIGLDQIWDDLRAGIQQVYTRQSMAKSRYMELYTHVYNYCTSVHQSN
QARGAGVPPSKSKKGQTPGGAQFVGLELYKRLKEFLKNYLTNLLKDGEDLMDESVLKFYT
QQWEDYRFSSKVLNGICAYLNRHWVRRECDEGRKGIYEIYSLALVTWRDCLFRPLNKQVT
NAVLKLIEKERNGETINTRLISGVVQSYVELGLNEDDAFAKGPTLTVYKESFESQFLADT
ERFYTRESTEFLQQNPVTEYMKKAEARLLEEQRRVQVYLHESTQDELARKCEQVLIEKHL
EIFHTEFQNLLDADKNEDLGRMYNLVSRIQDGLGELKKLLETHIHNQGLAAIEKCGEAAL
NDPKMYVQTVLDVHKKYNALVMSAFNNDAGFVAALDKACGRFINNNAVTKMAQSSSKSPE
LLARYCDSLLKKSSKNPEEAELEDTLNQVMVVFKYIEDKDVFQKFYAKMLAKRLVHQNSA
SDDAEASMISKLKQACGFEYTSKLQRMFQDIGVSKDLNEQFKKHLTNSEPLDLDFSIQVL
SSGSWPFQQSCTFALPSELERSYQRFTAFYASRHSGRKLTWLYQLSKGELVTNCFKNRYT
LQASTFQMAILLQYNTEDAYAVQQLADSTQIKMDILAQVLQILLKSKLLVLEDENANVDE
VELKPDTLIKLYLGYKNKKLRVNINVPMKTEQKQEQETTHKNIEEDRKLLIQAAIVRIMK
MRKVLKHQQLLGEVLTQLSSRFKPRVPVIKVQSHMAQASGSLVWEREEETESREVTVL
NT seq 2337 nt   +upstreamnt  +downstreamnt
atgtcatcaaacaggagtcagaatccccatggactgaagcagattggccttgaccagatc
tgggacgacctcagagctggaatccagcaggtgtacaccagacagagcatggcgaaatcc
agatacatggaactctacactcacgtttataactactgcacgagtgttcaccagtccaac
caagcgcgaggggctggcgtccccccttctaaatcaaaaaaggggcagacgcccggggga
gcccagtttgttggcttggagttatataaacgacttaaggaatttttgaagaattacttg
acaaaccttcttaaggatggagaagatttgatggacgagagtgtactgaagttctatact
caacagtgggaagattaccgattttcaagcaaagtgctgaacggaatttgtgcctacctc
aatagacactgggttcgccgtgaatgtgatgaaggacggaaaggaatatacgaaatttat
tctctcgcgttggtgacttggagagattgtctgttcaggccattgaataaacaggtaaca
aatgctgttttaaaactgattgaaaaggaaagaaatggtgaaaccatcaatacaagactg
attagtggagttgtacagtcttacgtggaattggggctgaatgaagacgatgcgtttgca
aagggccccacgttaacagtgtataaagaatccttcgagtctcagtttctggctgacaca
gagagattttataccagagagagcaccgaattcttgcagcagaacccagttactgaatat
atgaaaaaggcagaggcccgcctgctggaggagcagcgaagagtgcaggtctaccttcac
gagagcacccaggacgagctcgcgcggaagtgcgagcaagtgctcattgagaagcacctg
gaaatcttccacacggagtttcagaacctgttggatgctgacaaaaatgaggatctgggt
cgcatgtataatcttgtgtctagaatccaggatggcctaggagaattgaagaaacttttg
gagacgcacattcataatcagggtcttgcagcaattgaaaagtgtggagaagctgcttta
aatgaccccaaaatgtacgtacagacagtgttggacgttcataaaaagtacaacgccctg
gtcatgtctgcattcaacaacgatgcgggcttcgtggccgcactggacaaggcttgcggt
cgcttcataaacaacaacgcagttaccaaaatggcacagtcgtccagtaaatcccctgag
ctgctggcccgatactgcgactccttgttgaagaagagttccaagaacccagaagaagca
gaactagaagatacactcaatcaagtgatggtcgtcttcaagtacatagaggataaggac
gtgtttcagaagttctacgcaaagatgctagccaagagactcgtgcatcagaacagtgcg
agcgacgatgccgaagcgagcatgatctccaaactgaagcaagcctgcggcttcgagtac
acctccaagctgcagcggatgttccaggacatcggcgtgagcaaagacctgaacgagcag
ttcaaaaagcacctgacgaattcagagccgctggacttggacttcagtattcaggttctg
agctccggatcgtggccgtttcagcagtcctgcaccttcgccctgccgtcggagctggag
cgcagctaccagcgcttcacggctttttacgcgagccgtcacagcggccggaagctgacg
tggctgtatcagctgtccaaaggagagctggtgacaaactgcttcaaaaacagatacacc
ttgcaggcgtccacgttccagatggcgatcctgctgcaatacaacacggaagacgcgtac
gccgtgcagcagttggcggacagcactcagatcaaaatggacattttggcacaagttcta
cagattttattgaagtcaaagttattggtcttggaagacgaaaatgcaaacgtcgacgag
gtggaactgaagccagacaccttgataaaattgtatcttggttataaaaataagaaatta
agggttaacatcaatgtgccaatgaaaaccgaacagaagcaggaacaagaaaccacacat
aaaaatattgaggaagatcgcaaactcctgattcaggcagctattgtgagaattatgaaa
atgaggaaagtcctgaagcaccagcagttactcggagaagtgctcacgcagctgtcctcg
cggttcaagcctcgggtcccagtaattaaggtacaaagtcacatggcacaggcgtcaggc
tcgttagtttgggagagagaagaggagactgaaagtagggaagttactgttttataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107506799
Entry
107506799         CDS       T06036                                 

Gene name
SKP1
Definition
(RefSeq) S-phase kinase-associated protein 1
  KO
K03094  S-phase kinase-associated protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04141  Protein processing in endoplasmic reticulum
ray04310  Wnt signaling pathway
ray04350  TGF-beta signaling pathway
ray04710  Circadian rhythm
ray05132  Salmonella infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107506799 (SKP1)
   04120 Ubiquitin mediated proteolysis
    107506799 (SKP1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107506799 (SKP1)
   04350 TGF-beta signaling pathway
    107506799 (SKP1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107506799 (SKP1)
   04114 Oocyte meiosis
    107506799 (SKP1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    107506799 (SKP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107506799 (SKP1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107506799 (SKP1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107506799 (SKP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107506799 (SKP1)
   03036 Chromosome and associated proteins [BR:ray03036]
    107506799 (SKP1)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Adaptor protein
     107506799 (SKP1)
   Cul7 complex
     107506799 (SKP1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     107506799 (SKP1)
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107506799 (SKP1)
SSDB
Motif
Pfam: Skp1_POZ Skp1
Other DBs
NCBI-GeneID: 107506799
NCBI-ProteinID: XP_015993142
LinkDB
Position
Unknown
AA seq 163 aa
MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQ
WCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTC
KTVANMIKGKTPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK
NT seq 492 nt   +upstreamnt  +downstreamnt
atgccttcaattaagttgcaaagttctgatggagagatatttgaagttgatgttgaaatt
gccaaacaatctgtgactatcaagaccatgttggaagatttgggaatggatgatgaaggt
gatgatgacccagttcctctaccaaatgttaatgcagcaatattaaaaaaggtcattcag
tggtgcacccaccacaaggatgaccctcctcctcctgaggatgacgagaacaaagaaaag
cgaacagatgatatcccagtttgggaccaagaattcctgaaagttgaccaaggaacactt
tttgaacttatactggctgcaaactacttagacatcaaaggtttgcttgatgttacatgc
aagactgttgccaatatgatcaaggggaaaactcctgaggagattcgcaagaccttcaat
atcaaaaatgactttactgaagaagaagaagcccaggtacgcaaagagaaccagtggtgt
gaagagaagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519712
Entry
107519712         CDS       T06036                                 

Gene name
RBX1
Definition
(RefSeq) E3 ubiquitin-protein ligase RBX1
  KO
K03868  E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03420  Nucleotide excision repair
ray04066  HIF-1 signaling pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04141  Protein processing in endoplasmic reticulum
ray04310  Wnt signaling pathway
ray04350  TGF-beta signaling pathway
ray04710  Circadian rhythm
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107519712 (RBX1)
   04120 Ubiquitin mediated proteolysis
    107519712 (RBX1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    107519712 (RBX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107519712 (RBX1)
   04350 TGF-beta signaling pathway
    107519712 (RBX1)
   04066 HIF-1 signaling pathway
    107519712 (RBX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107519712 (RBX1)
   04114 Oocyte meiosis
    107519712 (RBX1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    107519712 (RBX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519712 (RBX1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    107519712 (RBX1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107519712 (RBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107519712 (RBX1)
   03400 DNA repair and recombination proteins [BR:ray03400]
    107519712 (RBX1)
Enzymes [BR:ray01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.32  cullin-RING-type E3 NEDD8 transferase
     107519712 (RBX1)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   107519712 (RBX1)
  Multi subunit Ring-finger type E3
   SCF complex
    Ring finger protein
     107519712 (RBX1)
   ECV complex
     107519712 (RBX1)
   Cul3 complex
     107519712 (RBX1)
   Cul4 complex
     107519712 (RBX1)
   Cul7 complex
     107519712 (RBX1)
   Cul9 complex
     107519712 (RBX1)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      107519712 (RBX1)
    TCR (transcription coupled repair) factors
     Cul4-CSA complex
      107519712 (RBX1)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4 zf-RING_11 zf-C3HC4_3
Other DBs
NCBI-GeneID: 107519712
NCBI-ProteinID: XP_016018152
LinkDB
Position
Unknown
AA seq 108 aa
MAAAMDVDTPTGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ
ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH
NT seq 327 nt   +upstreamnt  +downstreamnt
atggcggcagcgatggatgtggataccccgaccggcaccaacagcggcgcgggcaagaag
cgctttgaagtgaaaaagtggaatgcagtagccctctgggcctgggatattgtggttgat
aactgtgccatctgcaggaatcacattatggatctctgcatagaatgtcaagctaaccag
gcgtctgctacttctgaagagtgcaccgttgcctggggagtctgtaaccatgcttttcac
ttccactgcatctctcgctggctcaaaacgcggcaggtgtgtccgctggacaacagagag
tgggaattccaaaagtatggccactaa

DBGET integrated database retrieval system