KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500540
Entry
107500540         CDS       T06036                                 

Gene name
CACNA1C
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04727  GABAergic synapse
ray04728  Dopaminergic synapse
ray04742  Taste transduction
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04921  Oxytocin signaling pathway
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04927  Cortisol synthesis and secretion
ray04929  GnRH secretion
ray04930  Type II diabetes mellitus
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray05010  Alzheimer disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05031  Amphetamine addiction
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107500540 (CACNA1C)
   04020 Calcium signaling pathway
    107500540 (CACNA1C)
   04024 cAMP signaling pathway
    107500540 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    107500540 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107500540 (CACNA1C)
   04929 GnRH secretion
    107500540 (CACNA1C)
   04912 GnRH signaling pathway
    107500540 (CACNA1C)
   04921 Oxytocin signaling pathway
    107500540 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    107500540 (CACNA1C)
   04924 Renin secretion
    107500540 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    107500540 (CACNA1C)
   04927 Cortisol synthesis and secretion
    107500540 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107500540 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    107500540 (CACNA1C)
   04270 Vascular smooth muscle contraction
    107500540 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    107500540 (CACNA1C)
   04727 GABAergic synapse
    107500540 (CACNA1C)
   04725 Cholinergic synapse
    107500540 (CACNA1C)
   04728 Dopaminergic synapse
    107500540 (CACNA1C)
   04726 Serotonergic synapse
    107500540 (CACNA1C)
   04720 Long-term potentiation
    107500540 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    107500540 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    107500540 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107500540 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107500540 (CACNA1C)
   05020 Prion disease
    107500540 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    107500540 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    107500540 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107500540 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107500540 (CACNA1C)
   05414 Dilated cardiomyopathy
    107500540 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107500540 (CACNA1C)
   04934 Cushing syndrome
    107500540 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107500540 (CACNA1C)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   107500540 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 107500540
NCBI-ProteinID: XP_015981380
LinkDB
Position
Unknown
AA seq 2198 aa
MLRAFVQPAMPAYQPLPSHPSAETEVKFKGTLVHEAQLNYFYTPPGGSSYGSPRPAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTVSSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLII
IGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAE
MLLKVYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKVMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEVVEKPAVEETKEEKIELKSIT
ADGESPPTTKINMDDLQPNENEDKSAYPNPETTGEEDEEEPEMPVGPRPRPLSELHLKEK
AVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRN
HILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSA
INVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQL
FKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFT
VSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQ
EQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLIL
LNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLI
VIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEENSR
ISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVF
GKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTE
GETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWA
EYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATL
FALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATF
LIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKA
MKEAVSAASEDDIFRRAGGLFGNHVVSYYQSDGRSAFPQTFTAQRPLHINKAGNSQGDTE
SPSHEKLVDSTFTPSSYSSTGSNANINNANNTALARSPRPAGSPSAAGTSEGHGPPSSPA
VRVQEAAWKLNSKRCHSRESQIAMVCQEASQEETYDVKMSDDAEYCSEPSLIATETLSYQ
DDENRQLAPPEEDKRDIRQSPKRGFLRSSSLGRRASFHLECLKRQKNQGGDISQKTVLPL
HLVHHQALAVAGLSPLLQRSHSPTTFRRPCATPPATPGSQGWPPKPIPTLRLEGAESSEN
LNSSFPSIHCSSWAGESTPCGGASSATRKARPVSLTVPSQAGAWGRQFHGSASSLVEAVL
ISEGLGQFAQDPKFIEVTTQELADACDMTIEEMENAADNILSGGTQQSPNGTLLPFVNCR
DPGQDRAGVEEDEPCGPPRECRRGEEELQDSRAYVSGL
NT seq 6597 nt   +upstreamnt  +downstreamnt
atgcttcgagcctttgttcagcctgctatgcctgcataccagccgctccccagtcacccg
tctgccgaaacagaggtgaagtttaagggcactttggtgcatgaagctcaactcaactat
ttctacacacctcctggaggttccagctatgggagcccgcgcccagctcatgccaacatg
aatgccaatgcggcggcagggcttgcccccgagcacatccccaccccaggggcggccctg
tcctggcaggcagccatcgatgcggcccggcaggccaagctgatgggaagtgctggcaac
gcgaccatctccactgtcagctccacacagcggaagcggcagcagtacgggaaacccaag
aagcagggcagcacgaccgccacacgcccgcctcgcgccctgctctgcctgactctgaag
aaccccatccgcagggcgtgcataagcattgtcgaatggaaaccatttgaaatcattatt
ttactgactatttttgccaattgtgtggccttagcgatctatattccctttccagaagat
gactccaatgccaccaattccaacctggaacgagtggaatatctctttctcatcattttt
actgtggaagcatttttaaaagtaatagcctacggacttctctttcaccccaatgcttac
ctccgaaacggctggaatttactagattttataattgtggttgtagggctttttagtgca
attttagaacaagcaaccaaagctgacggggccaatgctctaggagggaaaggggctgga
tttgatgtgaaggctctgagggcgttccgcgtgctgcgccccttgcggctggtgtccgga
gtcccgagtctccaggtggtcctgaattccatcatcaaggccatggtccccctgctgcat
atcgccctgctagtgctgtttgtcatcatcatctatgctataatcggcctggagctcttc
atggggaagatgcataagacctgctacaatcaggagggcatagcagatgttccagcagaa
gatgatccttccccttgtgctctggagacgggccacggacgacagtgccagaatggcact
gtgtgcaagcccgggtgggatgggcccaagcacggcatcaccaacttcgacaactttgcc
ttcgccatgttgacagtgttccagtgcatcaccatggagggctggacagacgtgctgtac
tgggtcaatgatgccgtaggaagggactggccctggatctattttgttacacttatcatc
atagggtcattttttgtacttaacttggttctcggtgtccttagcggagagttttctaaa
gagagagagaaggccaaggctcggggagatttccaaaagctgagagagaagcagcagctg
gaagaggatctgaaaggctacttggactggatcacccaggcagaagacatcgaccctgag
aatgaggacgaaggcatggatgaggagaaaccccgaaacatgagcatgcccacaagtgag
acggagtctgtcaacactgagaacgtggctggaggtgacatcgagggagaaaactgtgga
gccaggctggcccaccggatctccaagtcgaagttcagccgctactggcgccggtggaat
cggttctgcagaagaaagtgtcgcgctgcagtcaagtccaatgtcttctattggctcgtg
atcttcctggtgttcctcaacacgctcaccatcgcctcggagcattacaaccagcctcac
tggctcacagaagtccaagacacagccaacaaggcactactggcccttttcacggcagag
atgctgctgaaggtgtacagcctgggattgcaggcctacttcgtgtccctgttcaaccgc
tttgactgcttcgtggtgtgcgggggcatcctggagaccatcctggtggagaccaaggtc
atgtcccccctgggcatctccgtgctcagatgcgtccggctactgaggatatttaaaatc
acaaggtactggaactccttaagcaacctggtggcatccttgctgaactccgtgcgctcc
atcgcctccctgctgctgcttctcttcctgttcatcatcatcttctccctcctgggaatg
cagctctttggaggaaagttcaactttgatgagatgcagacccggaggagtacatttgat
aactttccccagtccctcctcactgtgtttcagatcctgaccggggaggactggaattcg
gtgatgtatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgt
atttacttcatcatcctcttcatctgtggaaactatatcctactgaatgtgttcttggcc
attgccgtggacaacctggctgatgctgagagcctcacatctgcccaaaaggaggaagaa
gaagagaaggagaggaagaagctggccaggactgccagcccagaaaagaaacaagaggtt
gtggagaagccagcagtggaggagaccaaggaggagaaaatagagctgaaatccattaca
gccgatggagagtccccacccaccaccaagatcaacatggatgacctccagcccaatgaa
aatgaggataagagtgcctaccccaacccagaaactacaggagaagaggatgaggaggag
cccgagatgcctgtgggcccccgcccacgaccgctgtctgagctgcaccttaaggaaaaa
gcagtgcccatgccagaagccagtgcgtttttcatcttcagccccaacaacaggttccgc
ctccagtgccaccgcattgtcaatgacacgatcttcaccaacttgatcctcttcttcatt
ctgctcagcagcatctccctggcggctgaggaccctgtgcagcacacgtccttcaggaac
catattctattttattttgatattgtttttactaccattttcaccattgaaattgctctg
aagatgactgcttatggggctttcttgcacaagggctccttttgccggaactacttcaac
atcttggatctgctggtggtcagcgtgtccctcatctcctttggcatccagtccagtgcc
atcaatgtggtaaagatcttgcgagttctgagagtactcaggcccctgagggccatcaac
agagccaagggactgaagcacgtggttcagtgtgtgttcgtcgccatccggacgatcggg
aacatcgtgattgtcaccacactgcttcagttcatgttcgcctgcatcggggtccaactc
ttcaagggaaagctctacacctgttcagacagttccaagcagacagaggcagaatgcaag
ggtaactacatcacgtacaaggacggggaggtcgaccaccccatcatccagccccgcagc
tgggagaacagcaagttcgacttcgacaatgttctggcagctatgatggccctcttcact
gtctccacctttgaggggtggccagagctgctgtaccgctccatcgactcccacacggag
gacaagggccccatctacaactaccgcgtggagatctccatcttcttcatcatctacatc
atcatcatcgccttcttcatgatgaacatcttcgtgggtttcgtcatcgtcaccttccag
gagcagggcgagcaggagtacaagaactgtgagctggacaagaaccagcgacagtgtgtg
gaatacgccctcaaggcccggcccctgcggaggtacatacccaagaaccagcaccagtac
aaagtgtggtatgtggtcaactccacctactttgagtacctgatgttcgtcctcatcctg
ctcaacaccatctgcttggccatgcagcactacggtcagagctgcctgttcaaaatcgcc
atgaacatcctcaacatgctcttcactggcctcttcactgtggagatgattctgaagctc
attgccttcaaacccaagggttactttagtgatccctggaatgtttttgacttcctcatc
gtaattggcagcataattgacgtcattctcagtgaaactaatcactatttctgtgatgca
tggaatacatttgacgccttgattgttgtgggtagcattgttgatatagcaatcaccgag
gtaaacccagctgaacacacccaatgctctccctttatgaacgcagaggagaactcccgc
atctccatcaccttcttccgcctcttccgggtcatgcgcctggtcaagctgctgagccgc
ggggagggcatccggaccttgctgtggaccttcatcaagtccttccaggccctgccctac
gtggccctgctgatagtgatgctcttcttcatttacgccgtgattgggatgcaggtgttt
gggaaaattgccctgaacgacaccacagagatcaaccggaataacaactttcagaccttc
ccccaagctgtgctgctcctcttcaggtgtgccaccggggaggcgtggcaggacatcatg
ctggcctgcatgccagggaagaagtgcgccccagagtcggagcccagcaacagcacagaa
ggggagacaccctgtggcagcagcttcgccgtcttctacttcatcagcttctacatgctc
tgtgccttcctgatcatcaacctcttcgtagctgtcatcatggacaactttgactacctg
acaagggattggtcaatccttggtccccaccatctggatgaatttaaaagaatctgggca
gagtatgaccctgaagccaagggtcgtatcaaacacctagacgtggtgaccctgctccgg
cggattcagcccccattgggttttgggaagctgtgccctcaccgcgtggcttgcaaacgc
ctggtctccatgaatatgcctctgaacagcgatgggacagtcatgttcaatgccaccctg
tttgccctggtccggacagccctaaggatcaaaacagaagggaacctggaacaagccaac
gaggagttgcgggccataatcaagaagatctggaagcggaccagcatgaagctgctggac
caggtggtgccccccgcaggcgatgatgaggtcacggttggcaagttttatgctactttc
ctgatccaagagtacttccggaaattcaagaagcgcaaagaacagggcctcgtgggcaag
ccgtcccagaggaatgccttgtccctgcaggctggcttgcgcactctacatgacatcggg
cccgagatccgacgagccatctctggagacctgacagctgaggaggagctggacaaagcc
atgaaggaggctgtgtctgctgcctccgaagatgacatcttcaggagggccggtggcctg
tttggcaaccacgtcgtcagctactaccaaagcgacggccggagcgccttcccccagacc
ttcaccgcccagcgcccgctgcacatcaacaaggcagggaacagccaaggtgacaccgaa
tctccatcccacgagaaactggtggactccaccttcacccccagcagctactcatccact
ggctccaacgccaacatcaacaacgccaacaacaccgccctggcccgctccccgcgcccc
gccggctcccccagcgcggccggaacctcggagggccacgggcccccctcgtctcctgct
gtccgggtgcaggaggcagcgtggaagctcaactccaagaggtgccactcccgggagagc
cagatagccatggtgtgtcaggaggcctcccaggaagagacctacgacgtgaagatgagt
gatgatgccgagtactgcagtgagcccagcctgatcgccacagagacgctctcctatcag
gatgatgaaaaccgacaactagcaccccctgaggaggacaagagggacatccggcaatct
ccaaagaggggtttcctccgctcatcctccctaggtcgaagggcctccttccacctggaa
tgtctgaagcgacagaagaatcaagggggagacatctctcagaagacagttctgcccttg
catctggtccatcatcaggcattggccgtggcaggcctgagcccactcctccagagaagc
cattcccccaccacgttccgcagaccatgtgccacccctccagccacgcccggcagccaa
ggctggcccccaaagcccatccccaccctgcggctggaaggagccgagtccagtgagaat
ctcaacagcagcttcccatccatccactgcagctcctgggctggggagtccacgccctgt
gggggggccagcagtgccacccggaaagcccggcctgtgtccctcacggtgcccagccag
gccggggcctggggcaggcagttccatggcagcgccagcagtctggtggaagcggtcttg
atttcagaaggactggggcagtttgctcaagatcccaaattcatcgaagtcacaacccag
gagctggctgatgcctgcgacatgaccatagaggagatggagaatgctgctgacaacatc
ctcagtgggggcacccagcagagccccaacggcaccctattaccttttgttaactgcagg
gacccggggcaggacagggcaggggtggaagaggacgagccctgcgggcccccgcgggag
tgccgaaggggcgaggaggagctgcaggacagccgagcctacgtcagcggcctgtag

DBGET integrated database retrieval system