KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500589
Entry
107500589         CDS       T06036                                 

Gene name
TGFBR1
Definition
(RefSeq) TGF-beta receptor type-1 isoform X1
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04060  Cytokine-cytokine receptor interaction
ray04068  FoxO signaling pathway
ray04144  Endocytosis
ray04218  Cellular senescence
ray04350  TGF-beta signaling pathway
ray04371  Apelin signaling pathway
ray04380  Osteoclast differentiation
ray04390  Hippo signaling pathway
ray04520  Adherens junction
ray04659  Th17 cell differentiation
ray04926  Relaxin signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05142  Chagas disease
ray05161  Hepatitis B
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05220  Chronic myeloid leukemia
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107500589 (TGFBR1)
   04350 TGF-beta signaling pathway
    107500589 (TGFBR1)
   04390 Hippo signaling pathway
    107500589 (TGFBR1)
   04371 Apelin signaling pathway
    107500589 (TGFBR1)
   04068 FoxO signaling pathway
    107500589 (TGFBR1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107500589 (TGFBR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107500589 (TGFBR1)
  09143 Cell growth and death
   04218 Cellular senescence
    107500589 (TGFBR1)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    107500589 (TGFBR1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107500589 (TGFBR1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107500589 (TGFBR1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107500589 (TGFBR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107500589 (TGFBR1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107500589 (TGFBR1)
   05212 Pancreatic cancer
    107500589 (TGFBR1)
   05225 Hepatocellular carcinoma
    107500589 (TGFBR1)
   05226 Gastric cancer
    107500589 (TGFBR1)
   05220 Chronic myeloid leukemia
    107500589 (TGFBR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107500589 (TGFBR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107500589 (TGFBR1)
   05161 Hepatitis B
    107500589 (TGFBR1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107500589 (TGFBR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107500589 (TGFBR1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107500589 (TGFBR1)
Protein kinases [BR:ray01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   107500589 (TGFBR1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr TGF_beta_GS Activin_recp Pkinase_fungal APH FTA2
Other DBs
NCBI-GeneID: 107500589
NCBI-ProteinID: XP_015981477
LinkDB
Position
Unknown
AA seq 505 aa
MEAAAAASRPRLFLLVLAAAAAMLVPGATALQCFCQLCTKDNFTCVTDGLCFVSVTETTD
NKIMHNSMCIAEIDLIPRDRPFICAPSSKIGSFTTPYCCKQDHCNKIGDTTVGPFSGKPS
PGLGPVELAAVIAGPVCFVCISLMLIVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLK
DLIYDMTTSGSGSGLPLLVQRTIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSRE
ERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVT
VEGMIKLALSTASGLAHLHMEIVGTQGKPAIAHRDLKSKNILVKKNGTCCIADLGLAVRH
DSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWEIARRCSIG
GIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYAN
GAARLTALRIKKTLSQLSQQEGIKM
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggaggcggcggccgctgcttcgcgcccccggctgttcctcctcgtgctagcggcggcg
gcggcgatgctggtcccgggggcgacggcattacagtgtttctgtcagctttgcacaaaa
gacaattttacttgcgtcacagatgggctctgctttgtctccgtcacagagaccacagat
aataaaattatgcacaatagcatgtgtatagctgaaattgacctaattcctcgagacagg
ccatttatatgtgcaccgtcttcaaaaattgggtctttcactacaccatactgctgcaag
caggaccactgcaataaaataggggacacgactgttggccctttttcaggaaagccatca
cctggccttggtcctgttgaactggcagctgtcattgctggaccagtctgctttgtctgc
atctcactcatgttgatagtatatatctgccataaccgcactgtcattcaccatcgtgtg
ccaaatgaagaagatccttcattagatcgcccttttatttcagagggtactacattaaaa
gatttaatttatgatatgacaacatcaggttctggatcaggtttaccattgcttgttcag
agaacaattgctagaactattgtgttacaagaaagtattggcaaaggtcgatttggagaa
gtttggcgaggaaaatggagaggagaagaagttgctgttaaaatattctcctctagagaa
gaacgctcatggttccgtgaggcagagatttatcaaactgtaatgttacgtcatgaaaac
atcttgggatttatagcagcggacaataaagacaatggtacgtggactcagctctggttg
gtgtcagattatcatgagcacggatccctttttgattatttgaatagatacacagtaact
gtggaaggaatgataaaacttgctctgtccacagcaagtggacttgcccatcttcacatg
gagattgttggtacccaaggaaaaccagccattgctcacagagatttgaaatcaaagaat
atcttggtaaagaagaatggaacttgctgtattgcagacttgggactggcagtaagacac
gattcagccacagatacaattgatattgctccaaaccacagagtgggaacaaaaaggtac
atggcccctgaagttctagatgattccataaatatgaaacactttgaatccttcaaacgt
gctgacatctatgcaatgggcttagtattctgggaaatagctcgacgatgttccattggt
ggaattcatgaagattaccagctgccttattatgatcttgtaccttctgatccatcagtt
gaagaaatgagaaaagttgtttgtgaacagaagttacggccaaatattccaaacagatgg
cagagctgtgaagccttgagagtaatggctaaaattatgagagaatgttggtatgccaat
ggagcagctaggcttacagctttgcggattaagaaaacattgtcacaactcagtcaacag
gaaggcatcaaaatgtaa

DBGET integrated database retrieval system