KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500669
Entry
107500669         CDS       T06036                                 

Gene name
BUB1
Definition
(RefSeq) mitotic checkpoint serine/threonine-protein kinase BUB1 isoform X1
  KO
K02178  checkpoint serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107500669 (BUB1)
   04114 Oocyte meiosis
    107500669 (BUB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107500669 (BUB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107500669 (BUB1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107500669 (BUB1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107500669 (BUB1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: Other
  BUB family
   107500669 (BUB1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     107500669 (BUB1)
SSDB
Motif
Pfam: Mad3_BUB1_I Pkinase PK_Tyr_Ser-Thr
Other DBs
NCBI-GeneID: 107500669
NCBI-ProteinID: XP_015981607
LinkDB
Position
Unknown
AA seq 1079 aa
MDDPENAFQMFEAHMQRYKGDDPLGEWESYMQWIEENFPENKEYSTTLLKQLMKEFLDKK
RYHDDPRFINYCLKFAEYNSDRHQFFEFLCNHGIGTRCSRLYIAWAAHLEASGELQLAGA
VFQRGLQSRAEPGEPLRQQYRLFQTRVTEAQLPAQARTSEPLHNAQILNQMMTSKPNPGS
NAACISKPQGSEASGVTSSACDKESNMEQRVVMISKSGYSAQPSLAARADIQQVVMYCKA
KLIRGDSEFSFEELRAQKYNQRRKHEQWVNEDRHYMKRKEANAFEEQLLKEKMDELHKKL
HQVAEPPQESLSAFQESPEVDPLCVGPSVGSQQEPSAPSLPAVTQQTSEHLGQRPRESPP
AVPPEANAVTVTLVSSAVSQNMIPPAPLTSQPVTDPMIAAAGKDARCVTRSTHGFKPPSG
AELTGDYSDPLLVLHLVPISLPGCDTHKVVNTGSFHTTPNTSLGVAQATPSTGQPSPTVH
TKEALGFIMNMFQAPTLPDVSDDQDEWPSLDQNEDAFEAQFQKNASSSGAWGVNKVISSL
SSAFSVFEDGNKENYGLPQPKNKPAGARTFGERCVSRFSPKPKEVLCSKEFPDDSTVWGV
HCPKTLAPSPRSPGGFTSATRLASTPSHKLLVGPVHALEDKENVVAAQYAHVTLDAREGN
VAQPSEDRKFSPMQEGSPASAAGGALTREAERGLAACTLTDADLATVAGCTNTDTGLGAE
QAQPCSPDLVVENPWDGELILKLLSGLPQPLHSHPDVFEWQCKLPAMKPKTEFQLGSLLV
YIDHLLGEGAFAQVYEVTHGDVKDTKSKQKFVLKVQKPANPWEFYIGTQLMERLKPSVRH
MFIRFYSAHFFRDGSVLVGDLHSYGTLLNAINLYKNTPEKVMPQALVLSFAISMLHMIEQ
VHGCDIIHGDVKPDNFILGSRVLEQDSEDDDLSAGLALIDLGQSIDMKLFPKGTTFTGKC
ETSGFQCTEMLSNKPWTYQIDYFGVAATVYCMLFGSYMKVKNEGGVWKPEGLFRRLPHLD
MWNEFFHIMLNIPDCRHLPSLDLLRQKLKKIFQQHYTNKIKTLRNRLIVLLLEYKRSRK
NT seq 3240 nt   +upstreamnt  +downstreamnt
atggatgacccggaaaacgccttccaaatgtttgaagcccatatgcagcggtacaagggt
gatgacccacttggtgaatgggaaagttacatgcagtggatagaagagaattttcctgag
aataaagaatactcgacaactctattaaaacagttaatgaaggagtttttagataagaag
agataccacgatgacccaagattcatcaattattgtttaaaatttgctgagtacaacagc
gaccgtcatcagttttttgagtttctgtgcaaccacgggattgggacgcggtgctcccga
ctgtatatagcctgggccgcacacctggaggccagcggtgagctgcagctcgccggcgct
gtcttccagaggggcctgcagagccgggcggagccaggcgaaccactgcggcagcagtac
aggttatttcagacacgtgtcactgaagcccaattgccagctcaagctagaacctcagaa
cctctgcataacgctcagattttaaaccagatgatgacatcaaaaccaaatccaggaagt
aatgcagcctgcatttctaagcctcagggttcagaagcttctggagtaacatcttcagct
tgtgataaagagtctaatatggaacaaagggtggtcatgatttctaaatcgggttactct
gcacagccttctctggcagccagagcggatatccagcaggtggttatgtactgcaaggca
aagctcattcgtggggactcagaattctcctttgaagagctgagagcccagaagtacaat
cagcggagaaagcacgagcagtgggtaaatgaagacagacattacatgaaaaggaaagaa
gcaaatgcttttgaagaacagctattgaaagagaaaatggatgaacttcataagaagttg
catcaagtggcggagccaccgcaggagagcctgtccgctttccaggagagtcctgaggtt
gacccactgtgcgtggggcccagtgtcggctcccagcaggaaccgagtgctccgtctctg
ccagctgtcacccagcagacttcagagcacctgggacagagacccagagagtcacctcca
gctgttcctcctgaggcaaatgctgtcactgtcactttggtgtcctcagctgtcagccag
aatatgattcctcctgctcctttgacatctcagccagtgacagatcccatgattgcagca
gccggaaaagatgccagatgtgtgaccagaagtactcacggattcaagccaccaagcgga
gcagagctgactggagactattccgatcccctgctggtgctgcatcttgtccccatctct
ctaccagggtgtgacacacacaaggttgtgaacacaggttcttttcacacgactccaaac
acgtccctgggagtggcccaggcaacgccgtcaacggggcagccgtcccccaccgtgcac
acgaaggaagccttaggcttcatcatgaatatgttccaggctcctacactgcctgatgtg
tccgatgaccaagatgaatggccatctctagatcaaaatgaagatgcatttgaggcccag
tttcaaaaaaatgcaagttcttctggggcttggggtgtcaataaggttatctcttcttta
tcatctgctttttctgtgtttgaagatggaaacaaagaaaattatgggttaccacagcct
aagaataaacccgcaggagccagaacctttggagaacgctgtgtaagcagattttcccct
aaaccaaaggaagtgctgtgttccaaggagtttcctgatgactcgactgtctggggtgtc
cactgccccaagacactggcacccagccccaggagcccaggaggctttacgtcagccaca
cggcttgcatccacgccttcccacaagcttctggtgggcccagtgcatgctctggaggac
aaagaaaatgtggtagcagcacagtatgcccatgtgactttggatgctcgtgaaggaaac
gtggcgcagccctcagaagacaggaagttcagcccaatgcaggagggaagcccagcatca
gctgcaggcggcgcgctgaccagagaggcagagcggggcctggcagcctgcaccctcacg
gacgctgaccttgccacggtggcagggtgcacaaacaccgacactggacttggggcagag
caggcacagccttgttcaccagaccttgttgttgagaatccgtgggatggtgaactgatt
ctcaaacttctctccgggcttcctcagcccttgcactcccatccagacgtttttgagtgg
cagtgcaagctccctgccatgaagcccaagaccgagttccagctgggttctctgctggtc
tacattgatcaccttctcggagaaggggcttttgcccaagtctatgaagttacccatggg
gatgtgaaggataccaaaagcaaacagaaatttgttttgaaggtccagaagcccgccaac
ccctgggagttctacattgggacccagctaatggagagattgaagcccagtgtgcgacac
atgtttatcaggttctactccgcccactttttccgggatggcagcgtgctggtgggggat
cttcacagctacgggacgctgctgaatgccatcaacctctataaaaatacccctgagaaa
gtgatgcctcaagccctggtgctgtcctttgctatcagcatgctccacatgatagaacag
gtccacggctgcgacatcatccacggggacgtcaaaccggacaacttcatacttgggagc
agagttttggaacaggacagtgaagatgatgatttatctgccggcctggcactgattgac
ctgggtcagagcatagacatgaaacttttcccaaaaggaactacattcacaggaaagtgt
gaaacatccggtttccagtgtacggagatgctcagtaacaaaccgtggacctaccagatt
gattactttggagttgcagcaacagtgtactgcatgctttttggctcttacatgaaagtg
aaaaacgaaggcggagtctggaagcctgaaggtctttttagaaggcttcctcatctggac
atgtggaatgaattttttcacatcatgttgaatataccagattgtcgtcatcttccatct
ttggatttattaagacaaaagctgaagaaaatatttcagcagcactatacgaacaagatt
aagactctacgtaataggctaattgttctgctcttagaatataagcgttctcgaaagtaa

DBGET integrated database retrieval system