KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500692
Entry
107500692         CDS       T06036                                 

Gene name
ADORA2A
Definition
(RefSeq) adenosine receptor A2a
  KO
K04266  adenosine receptor A2a
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04270  Vascular smooth muscle contraction
ray05012  Parkinson disease
ray05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107500692 (ADORA2A)
   04020 Calcium signaling pathway
    107500692 (ADORA2A)
   04024 cAMP signaling pathway
    107500692 (ADORA2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107500692 (ADORA2A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107500692 (ADORA2A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    107500692 (ADORA2A)
  09165 Substance dependence
   05034 Alcoholism
    107500692 (ADORA2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107500692 (ADORA2A)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    107500692 (ADORA2A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 GPR_Gpa2_C 7TM_GPCR_Srx DUF4199
Other DBs
NCBI-GeneID: 107500692
NCBI-ProteinID: XP_015981643
LinkDB
Position
Unknown
AA seq 411 aa
MPTMGSSVYIVVELAIAVLAVLGNVLVCWAVWLNSNLQNVTNFFVVSLAAADIAVGVLAI
PFAITISIGFCAACHSCLFFACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGAR
AKGIIAICWVLSFAIGLTPMLGWNNCSQLKDRNHSQDCEEGQVACLFEDVVPMNYMVYYN
FFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGL
FALCWLPLHIINCFTFFCRECSHAPPWLMYLAIILSHSNSVVNPFIYAYRIREFRQTFRK
IIRSHILRQHEPFKAGGTSARALAAHGSDGEQISLRLNGHPSGVWANGSAPHPERRPNGY
ALGLVSGGGAHESHGDTGLQDMELLSHELRGASPESPGFDGPLAQDGAGVS
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgcccaccatgggctcctcggtgtacatcgtggtggagctggccattgctgtgctggcc
gttttgggcaatgtgctggtgtgctgggctgtgtggctaaacagcaacctgcagaacgtc
accaacttcttcgtggtgtcactggcggcagccgacatcgcggtgggagtcctcgccatc
ccctttgccatcaccatcagcatagggttctgtgccgcctgccacagctgcctcttcttc
gcctgctttgtcctggtcctcacacagagctccatcttcagcctcctggccatcgccatt
gaccgctacattgccatccgcatcccgctccggtacaatggcttggtgaccggcgcgagg
gccaagggcatcattgccatctgctgggtgctgtcctttgccatcggcctgacgcccatg
ctgggctggaacaactgcagtcagctgaaggacaggaaccactcgcaggactgcgaggag
ggccaggtggcctgtctcttcgaggacgtggtccccatgaactacatggtgtactacaac
ttctttgcttgtgtcctggtgccccttctgctcatgctgggtgtctacctgcgcatcttc
ctggcagcccggcggcagctgaagcagatggagagccagcctctgccgggggagcgggct
cggtccacgctgcagaaggaggtccacgcggccaagtcgctggccatcatcgtggggctt
ttcgccctctgctggctgcccctgcacatcatcaactgcttcaccttcttctgccgggag
tgcagccatgccccgccctggctcatgtacctggccatcatcctctcccactccaattct
gtcgtgaatcccttcatctacgcctaccgcattcgcgagttccgccagaccttccgcaag
atcattcgcagccacatcctgaggcagcatgagcccttcaaggcaggtggcaccagtgcc
cgggccttggcagctcacggcagtgatggagagcagatcagcctccgcctcaatggccac
ccttctggggtgtgggccaacggcagcgccccccatcctgaacggcggcccaatggctat
gccctggggctggtgagtggagggggtgcccacgagtcccatggggacacgggtctccag
gacatggagctcctcagccacgagctcaggggagcgagcccagaatcccccggctttgat
ggccccctggcccaggatggagcaggagtgtcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511058
Entry
107511058         CDS       T06036                                 

Gene name
ADORA2B
Definition
(RefSeq) adenosine receptor A2b
  KO
K04267  adenosine receptor A2b
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04270  Vascular smooth muscle contraction
ray05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107511058 (ADORA2B)
   04020 Calcium signaling pathway
    107511058 (ADORA2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107511058 (ADORA2B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107511058 (ADORA2B)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    107511058 (ADORA2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107511058 (ADORA2B)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    107511058 (ADORA2B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 GPR_Gpa2_C 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107511058
NCBI-ProteinID: XP_016000616
LinkDB
Position
Unknown
AA seq 332 aa
MPLEAQDALYVALELAIAALSVAGNVLVCAAVGTSSALQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFHSCLFLACFVLVLTQSSIFSLLAVAIDRYLAIRVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNCTESWDGTTNKSCCLVKCLFENVVPMSY
MVYFNFFGCVLPPLLIMLVIYIKIFMVACRQLQRTELMDHSRTILQREIHAAKSLAMIVG
IFALCWLPVHAINCVTLFQPAQAKDKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYTF
HKIISRYVLCQTDVLKSGNGQMGVEPALNVGL
NT seq 999 nt   +upstreamnt  +downstreamnt
atgccgctggaggcgcaggacgcgctgtacgtggcgctggagctggccatcgcagcgctg
tcggtggcgggcaatgtgctggtgtgcgctgcggtgggcacgtcgagcgcgctgcagacg
cccaccaactactttctggtgtccctggcggcggccgacgtggccgtggggctgtttgcc
atccccttcgccatcaccatcagcctgggcttctgcactgacttccacagttgcctcttc
cttgcctgcttcgtgctcgtgctcacgcagagctccatcttcagcctcttggcggtggcc
atcgacaggtacctggccatccgcgtcccgctcaggtataagagtttggtcactgggacc
cgagcgagaggagtcattgctgtcctctgggtccttgcctttggcattggactgacccca
ttcctggggtggaacagtaaagacagtgccaccaactgcacagagtcctgggatggaacc
acgaataaaagctgctgccttgtgaagtgtcttttcgagaacgtagtccctatgagctac
atggtatatttcaatttctttgggtgtgtcctgcccccactgctcataatgctagtgatc
tacatcaagatcttcatggtggcctgcaggcagcttcagcgcactgagctcatggaccac
tcaaggactatactccagcgggagatccatgcagctaagtccctagccatgatcgttggg
atttttgctctgtgttggctaccagtacatgctatcaactgtgtcactctttttcagcca
gctcaggctaaagataagcccaagtgggcaatgaacatggccattctcctgtcacatgcc
aattcagttgtcaatcccattgtctatgcataccggaaccgagatttccgctatactttt
cacaaaatcatctccaggtatgttctctgccagacagatgtcctcaagagtgggaatggg
cagatgggggtggagcctgctctcaatgtgggcctatag

DBGET integrated database retrieval system