KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500741
Entry
107500741         CDS       T06036                                 

Gene name
MOS
Definition
(RefSeq) proto-oncogene serine/threonine-protein kinase mos
  KO
K04367  proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
ray04810  Regulation of actin cytoskeleton
ray04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107500741 (MOS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107500741 (MOS)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107500741 (MOS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107500741 (MOS)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107500741 (MOS)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: Other
  MOS family
   107500741 (MOS)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal
Other DBs
NCBI-GeneID: 107500741
NCBI-ProteinID: XP_015981709
LinkDB
Position
Unknown
AA seq 348 aa
MPSPLPRRRFSPGEFSPSVDSRPCSSPSELPGKAGKLFPGTTPPRAPRLPRRLAWCSIDW
EQVHFLQRLGVGGFGSVYRATYHGVPVAIKQVNRCTKNPLASQRSFWAELNIARLRHDNI
VRVVAASTHTPEGFNSLGTIIMEFGGNVTLHQVIYGATSCPEEEVEPHCCAREELNLAKC
LKYALDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKIGDFGCSEKLEDLLSFQIPPYH
LGGTYTHRAPELLKGETVTPKADIYSFAITLWQMTTKDVPYLGERQYVLYAVVAYNLRPS
LAAAVFTDSIPGKRLEKIIQGCWRASALQRPSAEHLLVDLNSLKAEFG
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgccctcacctctcccgcggcgccgtttcagccccggcgagttttctccctctgtggac
tcacggccctgcagtagcccatctgagctcccaggtaaggcagggaagctcttcccaggg
accactcctcccagggccccacggctgccacgccggttggcctggtgttccattgactgg
gaacaggtgcacttcctgcagaggctgggagttgggggcttcggctcggtgtacagggca
acttaccatggtgtgccggtggccataaagcaagtgaacaggtgcaccaagaacccactg
gcatctcagcgcagtttctgggctgagctcaacattgcaagacttcgccatgacaacatc
gtgcgggttgtggctgccagcacacacacacctgagggctttaatagtttaggcaccatt
atcatggagtttggtggcaatgtcactttacaccaagtcatatacggtgctaccagctgc
cctgaggaggaagtggagcctcactgctgtgccagagaggaattaaatttggccaagtgt
ttgaaatatgccctggatgttgtgaatggactgctcttccttcattcacaaagcattgtg
cacttggacctgaagccagctaacattctgatcagtgagcaggatgtctgcaaaattggc
gactttggttgctctgagaagctggaagatctactgagcttccagattcctccataccac
ctaggcggtacctacacccaccgagccccggagctcctgaagggagagacggtaacaccc
aaagctgacatctattcttttgccatcactctctggcagatgactaccaaggacgtgcct
tacttaggggagcgtcagtacgtgctctacgctgtagtggcctataatctacgtccatct
ctcgcagcagctgtcttcactgactccatccctgggaaaagacttgagaagattatccag
ggctgctggagggccagtgctttgcagagaccaagtgcagaacatcttctggttgatctt
aactctctgaaagctgaatttggctga

DBGET integrated database retrieval system