KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500750
Entry
107500750         CDS       T06036                                 

Gene name
CDC26
Definition
(RefSeq) anaphase-promoting complex subunit CDC26
  KO
K03359  anaphase-promoting complex subunit 12
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107500750 (CDC26)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107500750 (CDC26)
   04114 Oocyte meiosis
    107500750 (CDC26)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107500750 (CDC26)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107500750 (CDC26)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107500750 (CDC26)
   03036 Chromosome and associated proteins [BR:ray03036]
    107500750 (CDC26)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107500750 (CDC26)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107500750 (CDC26)
SSDB
Motif
Pfam: ANAPC_CDC26
Other DBs
NCBI-GeneID: 107500750
NCBI-ProteinID: XP_015981733
LinkDB
Position
Unknown
AA seq 85 aa
MLRRKPTRLELKLDDIEEFENIRKDLETRKKQKEDVDVVGGSDGEGAIGLSSDPKSREQM
INDRIGYKPQAKPNNRSSQFGSFEF
NT seq 258 nt   +upstreamnt  +downstreamnt
atgctgcgacgaaaaccaacccgcctggagctgaagcttgatgacattgaggagtttgag
aacattcgaaaagacctggagactcgtaagaaacaaaaggaagatgtggatgttgtagga
ggcagtgatggcgaaggtgccattgggctcagcagtgaccccaagagccgggaacagatg
attaatgatcgaattggttataaaccccaagccaagcccaacaatcgttcgtctcaattt
ggaagttttgaattttag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503100
Entry
107503100         CDS       T06036                                 

Gene name
ANAPC2
Definition
(RefSeq) anaphase-promoting complex subunit 2 isoform X1
  KO
K03349  anaphase-promoting complex subunit 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107503100 (ANAPC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107503100 (ANAPC2)
   04114 Oocyte meiosis
    107503100 (ANAPC2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107503100 (ANAPC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107503100 (ANAPC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107503100 (ANAPC2)
   03036 Chromosome and associated proteins [BR:ray03036]
    107503100 (ANAPC2)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Cullin
     107503100 (ANAPC2)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107503100 (ANAPC2)
SSDB
Motif
Pfam: Cullin ANAPC2
Other DBs
NCBI-GeneID: 107503100
NCBI-ProteinID: XP_015986465
LinkDB
Position
Unknown
AA seq 816 aa
MAAAAGPPGPTQQLLAAWNTVSTGLVPPTALGLASSRTSGAVPPKEEELRAAVEVLRGHG
LHSVLEEWFVEVLQSDLQANISLEFWNAISQRENCADEPQCLLLLLDAFGLLESRLDPYL
RSLELLEKWTRLGLLMGTGVQGLREKVHTTVRGVLFFSTPRAFQEMVQRLYGRFLRVYMQ
SKRKGEGGTDPELEGDLDSRYARRRYYRLLQSPLCAGCGSDKQQCWCRQALEQFHQLSQV
LHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWLGKVFLQ
DGPARPASPEASSTLRRWRCHVQRFFYRVYASLRIEELFSIIRDFPDSRPAVEDLKYCLE
RTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVACEPIRR
YLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDWVPDPVD
ADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIRNVELLK
LRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPADEQPPFGVYAVILSSEFWPPFKD
EKLEVPEDIREALEVYCKKYEKLKAMRTLSWKHTLGLVTMDVELADRTLSVAVTPVQAVV
LLYFQDQASWTLEELSKVVKMPAALLRRRMSVWLQQGVLREEPAGTFSVVEEERPQDRDS
MVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLERIYSMLRMFVVTGPA
LAEIDLQELQGFLQKKVRDQQLIYAAGVYRLPRNCS
NT seq 2451 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggggccccccgggcccacgcagcagctgctggcggcctggaatacc
gtgagcaccgggctggtgccgccgaccgcgctgggactggcgtcctcccggaccagcggg
gccgtcccgccgaaggaggaggagctgcgggcggcggtggaggttctgaggggccacggc
ctgcactccgtcctggaggagtggttcgtggaggtgctgcagagcgacctgcaggccaac
atctccctggagttctggaatgccatctcccagcgcgagaactgtgcggacgagccccag
tgcctcctgctgctcctcgatgctttcggcctcctggagagccgcctggatccctacctg
cgtagcctggagctcctggagaagtggactcgcctgggcttgctgatgggcactggcgtc
caggggctgcgagagaaggtgcacaccacggtgcggggggtgctgttcttctccactccc
agagccttccaggagatggtccagcggctctatggccgcttcttgagagtctacatgcag
agtaagaggaaaggggaagggggcacagatccggaactggagggggacttggacagcagg
tatgcccgccgccggtactaccggctcctgcagagcccactgtgtgcgggatgtggcagt
gacaagcagcagtgctggtgccgccaagcactggagcagttccaccagctcagccaggtc
ctacacaggctcagtctgctggagcgagtcagtgccgaggctgtgaccaccaccctgcac
caggtcacccgggagaggatggaggaccgctgccggggcgagtatgagcgctccttcctg
cgtgagttccacaagtggatcgagagagtggtcggctggctgggcaaggtgttcctgcag
gacggccccgccaggcccgcgtcccccgaggccagcagcacgctgcgccgctggcgctgc
cacgtgcagaggttcttctaccgcgtgtacgccagcctgcgcatcgaggagctcttcagc
atcatccgagacttcccggactcccggccggccgtcgaggaccttaagtactgcctggag
aggactgaccagaggcagcagctgctggtgtccctgaaggccgccttggagacgcggctc
ctccacccaggtgtcaacacatgtgacatcatcactctctacatctctgccatcaaggca
ctgcgcgtactggacccctccatggtcatcctggaggtggcctgtgagcccattcgccgc
tacctgaggactcgggaggacacggtgcggcagatcgtggctgggctgacgggggactcg
gacgggacgggggacttggccgtcgagctgtccaagacagacccagcgagcctggagacc
ggccaggacagcgaggacgactccggcgagcccgaggactgggtccccgaccccgtggac
gccgacccaggcaagtccagctccaagcggcgctcctcagacatcatcagcctgctggtc
agcatctacggcagcaaggacctgttcatcaacgagtaccgctcgctgctggccgaccgc
ctgctgcaccagttcagcttcagccctgagcgggagatccgcaacgtggagctgctgaag
ctgcgcttcggagaggccccgatgcacttctgcgaggtcatgctgaaggatatggcggac
tcccgccgcatcaacgccaacatccgcgaggaggacgagaagcggcccgcggacgagcag
ccgccgtttggggtctacgccgtcatcctgtccagcgagttctggccccccttcaaggac
gagaagctggaggtccccgaggacatcagggaggccctggaggtctactgcaagaagtac
gagaagctgaaggccatgcggaccctcagctggaagcacaccctgggcctggtgaccatg
gacgtggagctcgctgaccgcaccctgtccgtggcggtgacgccagtgcaagccgtggtc
ttgctgtacttccaggaccaagccagctggaccctggaggagctgagcaaggtggtgaag
atgccggcggcgctgctgcggcggcgcatgtccgtgtggctgcagcagggcgtgctgcgg
gaggagccggccggcaccttctccgtggtggaggaggagcggccccaggaccgcgacagc
atggtcctcatcgacagcgacgacgagagcgactcgggcatggcctcccaggccgaccag
aaggaggaggagctgctgctcttctggacgtacatccaggccatgctgaccaacctggag
agcctgtcgctggagcgcatctacagcatgctgcgcatgttcgtggtgaccggccccgcg
ctggccgagatcgacctgcaggagctgcagggcttcctgcagaagaaggtgcgcgaccag
cagctcatctacgcggccggcgtctaccgcctgcccaggaactgcagctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508179
Entry
107508179         CDS       T06036                                 

Gene name
CDC27
Definition
(RefSeq) cell division cycle protein 27 homolog isoform X1
  KO
K03350  anaphase-promoting complex subunit 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107508179 (CDC27)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107508179 (CDC27)
   04114 Oocyte meiosis
    107508179 (CDC27)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107508179 (CDC27)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107508179 (CDC27)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107508179 (CDC27)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107508179 (CDC27)
   03036 Chromosome and associated proteins [BR:ray03036]
    107508179 (CDC27)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107508179 (CDC27)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107508179 (CDC27)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107508179 (CDC27)
SSDB
Motif
Pfam: TPR_1 TPR_2 ANAPC3 TPR_8 TPR_12 TPR_11 TPR_17 TPR_16 TPR_19 TPR_14 TPR_6 TPR_9 ChAPs PPTA TPR_MalT TPR_21 TPR_20 Cas_Cas02710
Other DBs
NCBI-GeneID: 107508179
NCBI-ProteinID: XP_015995334
LinkDB
Position
Unknown
AA seq 825 aa
MTVLQEPVQAAIWQALNHYAYRDAVFLAERLYAEVHSEEALFLLATCYYRSGKAYKAYRL
LKGHSCTTPQCKYLLAKCCVDLSKLAEGEQILSGGVFNKQKSHDDIVTEFGDSACFTLSL
LGHVYCKTDRLAKGSECYQKSLSLNPFLWSPFESLCEIGEKPDPDQTFKLTSLHNFSNCL
PNSCTTVVSNHNLSHRQPETVLTETPQDTIELNRLNLESSNSKYSLNTDSSVSYIDSAVI
SPDTVPLGTGTSILSKQVQNKPKTGRSLLGGPAALSPLTPSFGILPLETPSPGDGSYLQN
YTNTSSVIDVPPTGAPSKKSVARIGQTGTKSVFSQSGNSREVTPVLVAQTQSSGPQTSTT
PQVLSPTITSPPNALPRRSSRLFTSDSSTTKENSKKLKMKFPPKIPNRKTKSKTNKGGIT
QPNINDSLEITKLDSSIISEGKISTITPQIQAFNLQKAAAEGLMSLLREMGKGYLALCSY
NCKEAINILSHLPSHHYNTGWVLCQIGRAYFELSEYMQAERIFSEVRRIENYRVEGMEIY
STTLWHLQKDVALSVLSKDLTDMDKNSPEAWCAAGNCFSLQREHDIAIKFFQRAIQVDPN
YAYAYTLLGHEFVLTEELDKALACFRNAIRVNPRHYNAWYGLGMIYYKQEKFSLAEMHFQ
KALDINPQSSVLLCHIGVVQHALKKSEKALDTLNKAIVIDPKNPLCKFHRASVLFANEKY
KSALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIKEAI
DKRYLPDDEEPITQEEQIMGTDESQESSMTDADDTQLHAAESDEF
NT seq 2478 nt   +upstreamnt  +downstreamnt
atgacggtgctgcaggaacctgtccaggctgctatatggcaagcactaaaccactatgct
taccgagatgcggttttcctcgcagaacgactgtatgcagaagtacactcagaagaagcc
ttgtttttattggcgacctgttattaccgctcaggaaaggcatataaagcgtatcgactc
ttgaaaggacacagttgtactacaccgcaatgtaaatacctgcttgcaaaatgttgtgtt
gatctcagcaagcttgcagaaggggaacagatcttatctggtggggtgtttaacaaacaa
aaaagccatgatgatattgttactgagtttggtgattcagcttgctttactctttcattg
ttgggacatgtatattgcaagacagatcggcttgccaaaggatcagaatgttaccaaaag
agccttagtttaaatcctttcctctggtccccctttgaatcattatgtgaaataggtgaa
aagccagatcctgaccaaacatttaaattaacatctttacataactttagcaactgtctg
cccaactcctgcacaacagtagtatctaatcataatttatctcacagacagcctgagaca
gttcttacggaaacaccccaggacacaattgaattaaacagactgaatttagaatcttcc
aattcaaagtattccttgaatacagattcctcagtatcttatattgattcagctgtaatt
tcaccagatactgtccctcttggaacaggaacttccatattatctaaacaggttcaaaat
aaaccaaaaactggtcgaagcttattaggaggaccagctgctcttagcccattaacccca
agttttgggattttgccattagaaaccccaagtcctggagatggatcctatttacaaaac
tacactaatacatcttctgtaattgacgtgccacccaccggagccccttcaaaaaagtct
gttgccagaatcggccaaactggaacaaagtctgtcttctcgcagagtggaaatagtcga
gaggtgactccagttctcgttgcacaaacacaaagttctggcccacaaacaagtacaact
cctcaggtattgagccccactatcacatctcccccaaatgcactgcctcgaagaagttca
cgactttttactagtgacagttctacaaccaaggagaatagcaaaaaattaaaaatgaag
tttccacctaaaatcccaaacagaaaaacaaaaagtaaaactaataaaggaggaataact
caacctaacataaatgatagcctggaaattacaaaattggactcttccatcatttcagaa
ggaaaaatctccacaatcacacctcagatccaggcatttaatctacagaaagcagcagca
gaaggtttgatgagccttcttcgtgaaatggggaaaggttatttagctttgtgttcatac
aactgcaaagaagctataaatatcttgagccacctaccttctcatcactacaatactggc
tgggtattgtgccaaattggaagggcctattttgaactttcagagtacatgcaagctgaa
agaatattctcagaggttagaagaattgagaattacagagttgaaggcatggagatctac
tctacaacactttggcatcttcaaaaggacgttgctctttcagttctttcaaaagactta
acagatatggataaaaattcaccagaagcctggtgtgctgcagggaactgtttcagtttg
caacgggaacatgatattgcaattaaattcttccagagagctatccaggttgatccaaat
tatgcttatgcctatactctattagggcacgagtttgtattaactgaagaattagacaaa
gctttagcttgttttcgaaatgctatcagagtcaatcctagacattataatgcatggtat
ggtttaggaatgatttattacaagcaagaaaaattcagccttgcagaaatgcatttccag
aaagcacttgatatcaaccctcaaagttcagttttactttgccacattggagtagttcag
catgcactgaaaaaatctgagaaggctttggataccctaaacaaagccatcgttattgat
cccaagaaccctctatgcaaatttcacagagcctcagttttatttgcaaatgaaaaatat
aagtctgctttacaagaacttgaagaattgaaacaaattgttcccaaagaatccctcgtg
tacttcttaataggaaaggtttacaagaagttaggtcagacgcacctcgccctgatgaat
ttctcttgggctatggatttagatcctaaaggagccaataaccagattaaagaggccatt
gataagcgctaccttccagatgatgaggagccaataacccaagaagaacagatcatggga
acagatgaatcccaggagagcagcatgacagatgcagatgatacacaacttcatgcagct
gaaagtgatgaattttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508490
Entry
107508490         CDS       T06036                                 

Gene name
ANAPC13
Definition
(RefSeq) anaphase-promoting complex subunit 13
  KO
K12456  anaphase-promoting complex subunit 13
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107508490 (ANAPC13)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107508490 (ANAPC13)
   04114 Oocyte meiosis
    107508490 (ANAPC13)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107508490 (ANAPC13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107508490 (ANAPC13)
   03036 Chromosome and associated proteins [BR:ray03036]
    107508490 (ANAPC13)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107508490 (ANAPC13)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107508490 (ANAPC13)
SSDB
Motif
Pfam: Apc13p
Other DBs
NCBI-GeneID: 107508490
NCBI-ProteinID: XP_015995834
LinkDB
Position
Unknown
AA seq 74 aa
MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDL
ALQYLHENVPPIGN
NT seq 225 nt   +upstreamnt  +downstreamnt
atggacagtgaggtacagagagatggaaggatcttggatttgattgacgatgcttggcga
gaagataagctgccttacgaggatgttgcaataccactgaatgagcttcctgaacctgaa
caggacaacggtggcaccacagaatctgttaaagaacaagaaatgaaatggaccgacttg
gccttacagtacctccatgagaacgttccccccataggaaactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509936
Entry
107509936         CDS       T06036                                 

Gene name
ANAPC1
Definition
(RefSeq) anaphase-promoting complex subunit 1
  KO
K03348  anaphase-promoting complex subunit 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107509936 (ANAPC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107509936 (ANAPC1)
   04114 Oocyte meiosis
    107509936 (ANAPC1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107509936 (ANAPC1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107509936 (ANAPC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107509936 (ANAPC1)
   03036 Chromosome and associated proteins [BR:ray03036]
    107509936 (ANAPC1)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107509936 (ANAPC1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107509936 (ANAPC1)
SSDB
Motif
Pfam: APC1_C ANAPC1 PC_rep
Other DBs
NCBI-GeneID: 107509936
NCBI-ProteinID: XP_015998366
LinkDB
Position
Unknown
AA seq 1945 aa
MSNFYEERATMIAAGDLQEFVPFGRDHCKHHPNALNLQLRQLQPASELWSSDGAAGLVGS
LQEVTIHEKQKESWQLRKGVSEIGEEVDYDEELYVAGNMVIWSKGSKSQALAVYKAFTVD
SPVQQALWCDFIISQDKSEKAYSSDEVEKCICILQSSCINMHSIGGKDYIASLPFQVAGV
WPTKYGLLFERSTSAHEAPPGPPREPLPTMFSMLHPLDEITPLVCKSGSLFGSSRVQYVV
DHAMKIVFLNTDPSIVMTYDTVQSLHSVWVLRRVKTEEENVVLKFSEQGGTPQNVATSSS
LTAHLRSLSKGDSPVGSPFQNYSSVHSQSRSTSSPSLHSRSPSISNMAALSRAHSPASGA
HSFSGVQRFNLSSHNQSPRRHSISQSPNSHSNGSFLAPETEPIVPELCIDHVWTEAITSL
REKNSQASKVFITSDLCGQKFLCFLVESQLQLRCVKFQESNDKTQLIFGSITNLQAKDAA
PVEKLDTMLVLESSGNLVLYTGVVRVGKVFIPGLPAPSLTASRAVPRPSTPLDSMSTPEP
LSKLLGSLDEAVLLSPVPELRDSSKLHDSLYNEDCTFQQLGTYIHSVRDPVRNRVTLELS
NGTMVRITLPEIATSELVQTCLQAIKFILPKEIAVQMLVKWYSVHSAPGSPSYHSEWNLF
VICLMNMMGYNTDRLAWTRNFDFEGSLSPVIAPKKARPSETGSDEDWEYLLNSDYHQSAE
SHLLSRSLCLSPLEAPEVKGEDSSQSLSLDSSTLLFSHMPAVFFVLHLVYEELKLNTLMG
EGSRSLVDLLVQLARDLKLEPYLDHYYRDYPTLVRTTGQVCTVDPGQTGFMHHPSFFTSE
PPSIYQWVSSCLKGEGSPPYPYLPGACERSRLVVLSIALYILGDESSVSDESSSQYLSRI
TPAPQKSQAEQEENRLSVRHSTSVSNLAERLVVWMTSVGFTLRDLETLPFGIALPIRDAI
YHCREQPASDWPEAVCLLIGRQDLSKQACEGNLPKGKSVLSSDVPSGTETEEEDDGMNDM
NQEVMSLIWSEDLRVQDVRRLLQSARPVRVSVVQCPELSDHELIEEKENRLLQLCQRTMA
LPVGRGMFTLFSYHPVPTEPLPIPKLNLTGRAPPRNTTVDLSSGNVDVPPNMASWASFHN
GVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTK
GHEMTSIGLLLGVSAAKLGTMDMCVTRLLSIHVPALLPPTSTELDVPHSVQVAAVVGIGL
VYQGTAHRHTAEVLLAEIGRPPGPEMEYCTDRESYSLAAGLALGMVCLGHGSNLVGMSDL
NVPEQLYQYMVGGHRRFQAGMHREKHKSPSYQIKEGDTINVDVTCPGATLALAMIYLKTN
NRSVADWLRAPDTMYLLDFVKPEFLLLRTLARCLILWDDISPDSKWVDSNVPQIIRENSI
SLSEIELPCSEDLNLETLSQAHVYIIAGACLSLGFRFAGSENLSAFNCLHKFAKDFMTYL
SAPNASVTGPYNLETCLSVVLLSLAMVMAGSGNLKVLQLCRFLHMKTGGEMNYGFHLAHH
MALGLLFLGGGRYSLSTSNSSIAALLCALYPHFPAHSTDNRYHLQALRHLYVLAAEPRLL
VPVDVDANTPCYALLEVTYKGTQWYEQTKEELMAPTLLPELHLLKQIRVKGPRYWELLID
LSKGTQHLKSILSKDGVLYVKLRAGQLSYKEDPMGWQSLLAQTVANRNSEARAFKPETIS
AFTSDPALLSFAEYFCKPTVNMGQKQEILDLFSSVLYECVTQETPEMLPAYVAMDQAVRR
LGRGEVSETAELWQIKLVLAFFSSRSHQERLQSPPKRGFFMSSEFLPVVKCAIDNALDQW
LQAGGDMCVHAYLSGQPRDESQLSALACFLVYHSVPAPRHLPPVGLEGSTSFAELLFKFK
QLKMPVRALLRLAPLLLGNPQPMVM
NT seq 5838 nt   +upstreamnt  +downstreamnt
atgtcgaacttctatgaagaaagggcaacaatgattgcagccggggatttgcaggaattt
gttcctttcggtcgagaccactgcaagcatcaccctaatgctctgaaccttcaactgcgc
cagctgcagccggcttctgaattatggtcgtccgatggtgctgctggcttggtggggtcc
cttcaggaggttacaatccatgagaaacagaaggaaagctggcagttaaggaaaggcgta
agcgaaattggagaagaagtggattatgatgaggaactctatgtggctggaaatatggtg
atctggagcaaagggagtaaaagccaggcgctggcagtttataaagcgtttacagttgac
agtcctgttcaacaggcattgtggtgtgacttcattatatcacaggataagtctgaaaaa
gcctacagtagcgatgaagtagagaagtgcatatgtatattgcaaagttcatgtattaac
atgcacagcataggaggaaaggattacatagcttctttaccttttcaggttgctggtgtc
tggcctactaagtatggactgttgtttgaacggagcacttctgcacatgaggcacctccc
ggcccgcccagagaacctttacccaccatgttcagcatgctgcatccactggatgaaata
accccacttgtttgtaaatcgggaagccttttcggttcatcacgggtgcaatatgttgta
gatcacgcgatgaaaatcgtttttctcaacacggacccctccattgtaatgacctatgac
actgttcagagtctacattctgtgtgggttctccggagagttaaaacagaggaagagaat
gttgtcttaaagttctctgaacaggggggcaccccccaaaatgtggccacgagtagctcc
ctcacagctcacctcagaagcctttccaaaggagactcccccgtgggctcgcctttccag
aattactcctcagtccacagtcagagccgctccacctcgtcacccagtctgcactctcgg
tctccttccatctccaacatggcagctctgagccgtgctcactcccctgcctcaggagcg
cactctttctcaggggtgcaaaggttcaacctttcaagccacaatcagtctccaaggaga
cacagcatttctcagtctccaaatagccattcaaatggctctttccttgcgccagaaacc
gagccgattgttcctgaactgtgtattgaccatgtatggacagaagcaatcaccagtttg
agagagaaaaattcacaggcctccaaagtgtttattacatctgacctatgtgggcagaag
ttcttgtgcttcttagtagagtcccagctccagttacgctgtgtgaagtttcaagaaagt
aatgataagacccagctcatctttggctccatcacgaacctgcaggcaaaggatgcagcg
ccagtggagaagttagacactatgctggtcctggaaagcagtggcaacctggtgctgtac
acaggcgtggttcgggtgggaaaagtttttatccctggcctgccagccccttctctgaca
gcatcccgtgcagtgcctcggcccagcactccgctagacagcatgagcacccctgagcct
ctgagtaagctgcttggatccttggatgaggctgttctattgtcaccggttccagaacta
agggattcttcaaaactccatgattctctctataatgaggattgcaccttccagcagctc
gggacttatatccactctgttagagaccctgtccgtaacagagtgactctcgagctgagt
aacggcaccatggtaaggatcactcttcctgaaatcgccacctctgaattagtacaaaca
tgtttgcaagccattaagtttatcctgcccaaagaaatagctgttcagatgctcgtcaag
tggtacagtgtccacagcgctccgggcagccccagctatcactcagagtggaatttattt
gtgatttgtctcatgaacatgatgggttataacacagaccgcttagcgtggacaagaaat
tttgactttgaaggatcactttctccagtcattgcacccaaaaaggcaaggccctctgag
acaggatctgatgaggactgggagtatttgctaaattcagactatcaccagagtgccgaa
tctcaccttctgagcaggtctctatgtctgagtcctttggaggctcctgaggtgaagggc
gaggactcatcacagagcctcagtctggactcctccacgcttctcttctcccacatgcct
gcagtgttttttgttctccaccttgtttatgaggagctcaagctgaacactctgatggga
gaaggaagtcgctcacttgttgacctgctcgttcagttggcaagggacttaaaattggag
ccttacttagatcattactatagagattacccgacgcttgtcagaactactggacaagtg
tgcacagttgatccaggtcaaacaggatttatgcatcatccatcatttttcacttccgag
ccaccaagtatttaccagtgggtgagttcttgtctgaagggcgaggggtcaccaccctac
ccctacctccctggtgcctgtgaaagaagccggctcgtggtcttgagtattgcactctac
attcttggtgatgaaagctctgtttctgatgaatcctcctcacagtatttatccagaata
actccagcaccccagaagtcacaagcagaacaagaggaaaacaggcttagtgtccggcat
tctacatcagtttctaatctagctgaaagattagttgtctggatgactagtgtaggtttc
actctaagggacttggaaacgcttccctttggaattgcgcttcccatcagagatgcaatt
tatcactgtcgggagcagcctgcgtcagactggccggaggctgtctgtctcttgatagga
cggcaggacctttccaagcaggcttgtgagggaaacttgcccaaagggaaatctgtgctt
tcctcagatgttccttcaggaacagagactgaggaggaggatgatggcatgaatgacatg
aatcaggaggtcatgtcactaatatggagtgaagatctgcgggtacaggatgtgcgaagg
ctgcttcaaagtgcgcgtccggtacgtgtcagcgtggtgcagtgcccagagctcagcgac
cacgaactcatcgaggagaaggagaacagattgctccagttgtgccagcgcacgatggcc
cttccggtgggacgaggaatgttcactttgttttcataccatcctgttccaacggagccg
ttgcctattcctaagctgaatttgactggccgtgccccgccgcgaaatacaactgtggac
ctcagcagcgggaacgtggacgtgccccccaacatggccagctgggccagcttccacaac
ggcgtggctgccggcctgaagatcgccccggcctctcagattgactcggcctggattgtg
tacaacaagcccaagcatgctgagctggccaatgagtacgcgggcttcctcatggccctg
ggcctgaatgggcatctcaccaagctggccactctcaatatccatgactacctgaccaag
ggtcatgaaatgacaagcattggactgctccttggtgtctctgctgctaagcttggaacc
atggacatgtgtgtcactcggctgctcagcatccacgtccccgctctcttgcccccaacg
tccacggagctggatgttcctcatagtgtccaggtggctgcagtggtcggcatcggcctg
gtgtatcaggggacagcccacagacacaccgcagaagtcctgttggctgagataggccgg
cctcctggtcccgagatggaatactgcacagacagagagtcctactctctagctgctggc
ctggccctaggcatggtctgcttggggcatggcagtaacttggtaggtatgtcggacctg
aatgtgcctgaacaactttatcagtacatggttggaggccaccggcgctttcaagcggga
atgcacagggagaagcataaatctccaagttaccaaatcaaagaaggagacaccataaat
gtggatgtgacgtgcccgggagccacacttgctctggctatgatctacctgaaaaccaac
aacagatctgtcgcagactggcttcgagctcctgacactatgtacctgctggactttgtg
aagccagagttcctgttgcttaggaccctggctcggtgcctgatcttgtgggatgacatt
tcaccagattccaagtgggttgatagcaatgtccctcagattatacgagaaaatagtatc
tctctcagcgaaatcgaattgccttgctctgaggatttgaatctggaaactttgtcgcaa
gcacatgtctatataattgcgggagcctgtttatctctgggttttcgatttgctggctca
gaaaacttatcagcatttaactgtttgcataaatttgcaaaagattttatgacttatttg
tctgcacctaatgcttctgtgacaggcccttacaacttggagacgtgcctgagtgtggtg
ctgctgtccctggccatggtcatggccggctctgggaacttaaaggttttgcagctgtgt
cgcttcttgcacatgaaaacaggtggtgaaatgaactatggttttcacttagcccatcac
atggcccttggacttctatttttgggaggtggaaggtactcgttgagcacctccaactcc
tccatcgctgccctcttgtgcgccctttacccacacttccctgctcacagcactgacaac
cggtatcatctccaggctctacggcacctgtatgtgctggctgcggaaccacggctgctg
gtgcctgtggatgtggatgccaacacaccctgctacgccctcttggaggtcacctataaa
ggcactcagtggtatgagcagaccaaagaggagctgatggcacccacccttcttccggag
ctccacctcctaaagcagatcagagttaaaggcccgcggtactgggagctgctcatcgat
ttaagcaaggggacgcagcacttgaagtccatcctttccaaggacggcgttttatatgtg
aagctcagagcaggccagctctcctacaaggaggacccaatggggtggcagagcttgctg
gcccagactgttgctaaccggaactctgaagcccgagctttcaagcctgaaacaatttca
gcattcacttctgacccagcgcttctgtcgtttgctgagtatttctgcaaacccactgtg
aacatgggccagaagcaggaaattctggatctcttctcttcagtgctctatgagtgtgtc
acccaggagacgccggagatgctacctgcatatgtggcaatggatcaggctgtgcggaga
ctggggcggggagaggtgtctgagacagcggagctttggcagatcaaattggtgctggcc
ttcttcagctccagaagccaccaggagcggctgcagagccccccaaagcgaggcttcttt
atgagctcagagttcctcccggtagtcaagtgtgcaattgacaatgccctggaccagtgg
ctacaagccgggggcgacatgtgcgtgcatgcctacctcagcggacagccccgggacgag
tctcagctgagcgcgctggcctgcttcctggtctaccactcagtgccggccccgcggcac
ctgcctcctgttggactggaagggagcacaagcttcgctgaactcctcttcaagtttaaa
cagctgaaaatgcccgtgcgagctctgctgaggttggcgcctttgctccttggaaacccg
cagccgatggttatgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513236
Entry
107513236         CDS       T06036                                 

Gene name
ANAPC7
Definition
(RefSeq) anaphase-promoting complex subunit 7 isoform X1
  KO
K03354  anaphase-promoting complex subunit 7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107513236 (ANAPC7)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107513236 (ANAPC7)
   04114 Oocyte meiosis
    107513236 (ANAPC7)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107513236 (ANAPC7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107513236 (ANAPC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107513236 (ANAPC7)
   03036 Chromosome and associated proteins [BR:ray03036]
    107513236 (ANAPC7)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107513236 (ANAPC7)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107513236 (ANAPC7)
SSDB
Motif
Pfam: TPR_2 TPR_8 TPR_14 TPR_19 TPR_16 TPR_1 ANAPC3 TPR_7 TPR_11 TPR_12 ChAPs TPR_21 TPR_17 TPR_10 BTAD
Other DBs
NCBI-GeneID: 107513236
NCBI-ProteinID: XP_016005153
LinkDB
Position
Unknown
AA seq 598 aa
MDPGEAAILESSLSVFYRLFVPLRPLPAALPGRMNVIDHVRDMAAAGLHSNVRLLSSLLL
TMSNNNPELFSPSQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALSKTSKVRPSTG
NSASAPQSQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKK
AGQERPSVTSYKEVLRQCPLALDAILGLLSLSVKGAEVASMTMNVIQSVPNLDWLSVWIK
AYAFVHTGDNSRAINTICSLEKKSLLRDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLD
PYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYL
GAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASN
SIREAMVMANNVYKTLGANAQTLTLLATVCLEDPVTQEKAKTLLDKALNQRPDYIKAVVK
KAELLSREQKYEDGIALLRNALANQSDCVLHRILGDFLVAVNEYQEAMDQYSIALSLDPN
DQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDSEAAQWADQEQWFGMQ
NT seq 1797 nt   +upstreamnt  +downstreamnt
atggaccccggcgaggccgccattttggagtcttccctcagcgtcttctaccggcttttc
gtgccgctgcggccgctccccgcggctttgccgggcaggatgaatgtgatagaccacgtg
cgagacatggcggccgcggggctgcactccaacgtgcggctcctcagcagcttgttactt
acaatgagtaataacaaccctgagctgttctccccatctcagaagtaccagcttttggtg
tatcatgcagattctctctttcatgataaggaatatcggaatgctgtgagtaagtatacc
atggctttacagcagaagaaagccctaagtaaaacttcaaaagtgagaccttcaactgga
aattctgcatctgctccacaaagtcagtgtcttccatctgaaattgaagtgaaatacaaa
atggctgaatgttacacgatgctaaaacaggataaagatgccattgctatacttgatggg
atcccttcaagacaaagaacacccaaaataaacatgatgctagcaaacctgtacaagaag
gctggtcaggagcgcccttcagtcaccagctataaggaggtgctgaggcagtgcccatta
gcccttgatgccattctaggtctgctgtctttgtctgtaaaaggtgcagaggtggcatcg
atgacaatgaatgtgatccagtctgtgcctaatttggattggctctctgtgtggatcaaa
gcatatgctttcgtgcatactggtgacaactcaagagcaatcaataccatctgttcacta
gagaaaaagtccttattgcgagataacgtggacctactgggaagcttagcagatctgtac
ttccgagctggagacaataaaaactcggtcctcaagtttgaacaggcacagatgttggat
ccttacctgataaaagggatggatgtgtatggctacctcctggcacgagaagggcggctg
gaggatgtagagaaccttggctgccgccttttcaatatttctgatcagcatgcagaaccc
tgggtagtatctgggtgccatagcttctacagcaaacgctactcccgggccctctatttg
ggggccaaggccatccagctgaacagtaacagtgttcaggccttactgctgaagggggca
gcactgaggaacatgggcagagtccaagaagcaataatccactttcgggaggccatacga
cttgctccttgtcgcttagactgttacgaaggtctcatcgaatgttacttagcctccaac
agtattcgtgaagcaatggtaatggctaacaacgtttacaaaactctaggagcaaatgca
cagacccttactttgttagctactgtttgtcttgaagacccagtgacacaggagaaagct
aaaactttattagataaagccctgaaccaaaggccggattacattaaggctgtggtgaaa
aaagcagaactacttagcagagagcagaaatatgaagatggaattgctttgctgaggaac
gcactagctaatcagagtgattgtgtcctgcaccggatcctaggagatttccttgtagct
gtcaatgagtatcaggaggcaatggaccagtatagtatagcactcagtttggaccccaat
gaccagaagtctctagaggggatgcagaagatggagaaggaggagagtcccacggatgcc
actcaggaggaggatgtggacgacatggaagggagtggggaagaaggggacctggagggc
agcgacagtgaggcggcccagtgggctgaccaggagcagtggttcggcatgcagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514354
Entry
107514354         CDS       T06036                                 

Gene name
CDC16
Definition
(RefSeq) cell division cycle protein 16 homolog
  KO
K03353  anaphase-promoting complex subunit 6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107514354 (CDC16)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107514354 (CDC16)
   04114 Oocyte meiosis
    107514354 (CDC16)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107514354 (CDC16)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107514354 (CDC16)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107514354 (CDC16)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107514354 (CDC16)
   03036 Chromosome and associated proteins [BR:ray03036]
    107514354 (CDC16)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107514354 (CDC16)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107514354 (CDC16)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107514354 (CDC16)
SSDB
Motif
Pfam: ANAPC3 TPR_2 TPR_1 TPR_12 TPR_8 TPR_7 TPR_10 TPR_19 TPR_11 TPR_9 TPR_16 SRP_TPR_like Dynein_light
Other DBs
NCBI-GeneID: 107514354
NCBI-ProteinID: XP_016007455
LinkDB
Position
Unknown
AA seq 620 aa
MNLERLRKRVRQYLDQQQYQSALFWADKVASLSHEEPQDIYWLAQCLYLTAQYHRAAHAL
RSRKLDKLYESCRYLAARCHYAAKEHQQALDILDMEEPINKRLFEKYLKDESGLKDPSND
WEMSQSSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQE
EKELLESLPLSKLCTEEQELLRFLFENKLKKYNKPSETIIPESVDGLQENLDVVVSLAER
HYYNCDFKMCYKLTSVVMEKDPFHANCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPV
SWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTA
AQLMKGCHLPMLYIGLEYGLTNNSKLAERFFGQALSIAPEDPFVMHEVGVVAFQNGEWKT
AEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNAS
TYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIGDSEAYIGADIKD
KLKCYDFDVHTMKTLKNIISPPWDFREFEVEKQTTEETGLAPLETSRKTPDSRPSLEETF
EIEMNESDMMLETSMSDHST
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgaacctggagcggctgcggaagcgcgttcggcagtacctggaccagcaacaatatcag
agtgctctattttgggcagataaagtagcttcgctttctcatgaggaaccccaggacatt
tattggttggctcagtgtctttacctgacagcacaatatcatagagcagctcatgcactt
cggtcgcgaaaactggataaattgtatgaatcatgtcgctaccttgcagctagatgccat
tatgctgcaaaagagcatcagcaggctcttgatattcttgatatggaggagccaatcaac
aaaagattatttgagaaatacttgaaggatgaaagtggcttgaaagacccctccaatgac
tgggaaatgtcacagtcctcaataaagagttctatttgtcttttacgtgggaaaatctat
gatgctctagataaccgaaccctagctacctacagctataaagaagctttgaagctcgat
gtctactgttttgaagcatttgatcttttgacatcacaccacatgttgacagcccaagaa
gaaaaagaacttcttgaatcactacctcttagcaagctctgtactgaagaacaggaattg
ctacgttttctatttgagaacaaattaaaaaagtataataaacctagtgaaactatcata
ccagagtctgtagatggtttacaagaaaatctggatgtggtagtgtctttagctgaaaga
cattattataactgtgattttaaaatgtgctacaagcttacatctgtagtaatggaaaaa
gatccttttcatgcaaattgtttacctgtacatatagggacacttgtggagctgaataaa
gcaaatgaacttttctatctttctcataaattggtggatttatatcctagtaatcctgtg
tcttggtttgcagtgggatgctattatctcatggttggtcataagaatgaacatgccaga
agatatctcagtaaagctacaacgcttgagaagacttacgggcctgcatggatagcatat
gggcattcatttgcagttgagagcgaacatgaccaagcaatggctgcctacttcacagca
gcacaactgatgaaagggtgccatttaccaatgctatatattggattagaatatggattg
accaataactccaaattggctgaaaggttctttggccaagctctaagcattgcaccagaa
gatccttttgtaatgcatgaggttggcgtggttgcatttcagaatggagaatggaaaaca
gcagaaaaatggtttcttgatgctttggaaaaaattaaagcaattgggaatgaggtaact
gttgacaaatgggaacctctgttgaacaacttggggcatgtctgcagaaaacttaaaaag
tatgctgaggcattggattatcaccgtcaggcattggtgttaattcctcaaaacgcatcc
acctattctgctatagggtatatccatagtctgatgggcaactttgaaaatgctgtggac
tatttccacacagcccttggtcttaggcgagatgatacattctctgttacaatgcttggt
cattgcattgaaatgtacattggtgattctgaagcttatattggagcagacataaaagac
aaattaaaatgttatgactttgatgtgcatacaatgaagacactaaaaaacattatttca
cctccgtgggatttcagggaatttgaagtagaaaaacagactacggaagaaacggggctt
gcaccactggaaacctcaaggaaaactccagattccagaccttccttggaagaaaccttt
gaaattgaaatgaatgaaagtgacatgatgttagagacatctatgtcggaccacagtacg
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515244
Entry
107515244         CDS       T06036                                 

Gene name
ANAPC5
Definition
(RefSeq) anaphase-promoting complex subunit 5
  KO
K03352  anaphase-promoting complex subunit 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04657  IL-17 signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107515244 (ANAPC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107515244 (ANAPC5)
   04114 Oocyte meiosis
    107515244 (ANAPC5)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107515244 (ANAPC5)
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107515244 (ANAPC5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107515244 (ANAPC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107515244 (ANAPC5)
   03036 Chromosome and associated proteins [BR:ray03036]
    107515244 (ANAPC5)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107515244 (ANAPC5)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107515244 (ANAPC5)
SSDB
Motif
Pfam: ANAPC5 TPR_12 TPR_10 TPR_MalT TPR_2 TPR_19 TPR_7 MapZ_EC1
Other DBs
NCBI-GeneID: 107515244
NCBI-ProteinID: XP_016009327
LinkDB
Position
Unknown
AA seq 755 aa
MASVHESLYFNPMMTNGVVHANVFGIKDWVTPYKIAVLVLLNEMGRTGEAAVSLMERRRL
NQLLLPLLQGPDITLSKLYKLIEESCPQLANSVQIRIKLMAEGELKDMEQFFDDLSDSFS
GTEPEVHKTSVVGLFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKAVEDADMELASR
EEGERKMEKEELDVSIREEEVSCSGPLSQKQAEFFLSQQASLLKNDETKALTPASLQKEL
NNLLKFNPDFAEAHYLSYLNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSL
RYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVL
LEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDI
SIAQKTAIWRLYGRSTMALQQAQMLLSMNSLEAANAGAQQNNTESFAVALCHLAELHAEQ
GCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIQFDRAMHDGKYHLADSLVTGITALNS
IEGVYRKAVVLQAQNQMSEAHKLLQKLLIHCQKIRNTEMVISVLLSVAELYWQSSSPTIA
LPVLLQALALSKEYRLQYLASETVLNLAFAQLILGIPEQALSLLHMAIEPILADGAVLDK
GRAMFLVAKCQVASAASYDPLKKAEAVEAAIENLNEAKNYFAKVDCKERIRDVVYFQARL
YHTLGRTQERNRCAMLFRQLHQELPSHGVPLINHL
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggccagcgtccacgagagcctctacttcaaccccatgatgaccaatggggtggtgcac
gccaacgtgttcggcatcaaagactgggtgacgccgtataagatcgcggtgctggtgctg
ctgaacgagatgggccgcacgggcgaggctgcggtcagcctcatggagcggcggaggctc
aaccagctgctcctgccactgctgcagggcccagatattacactgtcaaaactatacaag
ttaatcgaagaatcttgtcctcagctagcaaattcagtacagatcagaatcaaactgatg
gccgaaggcgaattgaaggatatggaacaattttttgatgacctttcggattctttttct
ggaactgaaccagaggttcacaaaacaagtgtagtaggtttatttctgcgtcacatgatc
ttggcttacagtaagctttctttcagtcaagtgtttaaactatacactgcccttcaacag
tacttccaaaatggtgagaaaaaggcagtggaggatgccgatatggaactcgccagcaga
gaagagggcgaaagaaaaatggaaaaagaagaacttgatgtatctataagagaagaggag
gtatcttgcagtgggccactgtcccaaaaacaggcagaattttttctttctcaacaggct
tctttgttaaagaatgatgagaccaaagccctcactccagcttctttgcagaaggaattg
aacaacttgttgaaatttaaccctgattttgctgaagcgcattatctcagctacttaaac
aacctccgggtccaagatgttttcagttcaacacacagcctcctgcattatttcgaccgc
ctgattcttactggagccgaaagcaaaagtaacggggaagagggctatggccggagcttg
aggtacgccgccctgaacctggccgccctgcactgccgcttcggacactatcaacaggca
gagcttgccctgcaggaggcgattaggattgcccaggagtccaacgatcatgtgtgtctc
cagcattgcttgagctggctttatgtgctggggcagaagagatctgatagctacgttctg
ctggagcattctgtgaagaaagcagtgcattttgggttaccgtacctcgcctccctgggg
atacagtcccttgtgcagcagagggcttttgccgggaagacggcgaacaagctgatggat
gcgctgaaggactccgacctcctgcactggaaacacagcctgtcggagctcatcgacatc
agcatcgcacagaaaacagccatctggaggctctatggccgcagcaccatggcgctgcag
caggcccagatgctgctgagcatgaacagcctggaggcggcgaacgcgggcgcgcagcag
aacaacaccgagtcgttcgccgtggcgctctgccacctcgccgagctgcacgcggagcag
ggctgtttcgctgccgcttcagaagtgttaaagcacctgaaggaacgattcccacctaac
agtcagcatgcccagttatggatgctgtgtgatcaaaaaatacagtttgacagagcaatg
catgatggcaaatatcatttggctgattcactcgttacaggaatcacagctcttaatagc
atagaaggtgtatatagaaaagcagttgtactacaagctcagaaccaaatgtcagaggca
cacaagcttttacaaaaattactgattcattgtcagaaaatcaggaacacagaaatggtg
atcagtgtcctgctgtccgtggccgagctgtactggcagtcttcctcccccaccatcgcg
ctgcccgtgctcctgcaggcgctggccctctccaaggagtaccggctgcagtacttggcc
tccgaaacagtgctgaacttggcctttgcccagctcatcctcggaatcccagaacaggcc
ttaagtctgctccacatggccatcgagcccatcttggctgacggcgccgtcctggacaaa
ggccgtgccatgttcttggtggccaagtgccaagtggcttcagcagcttcctacgaccca
ctgaagaaagcagaagccgtggaggccgccattgagaacctcaatgaagccaagaactat
tttgcaaaggtggactgcaaagagcgaatcagagacgtcgtttacttccaggccaggctc
taccacaccctggggaggacccaggagaggaaccgatgcgccatgctgttccggcagctg
caccaggagctgccctcccacggggtgcccttgatcaaccatctctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515713
Entry
107515713         CDS       T06036                                 

Gene name
ANAPC4
Definition
(RefSeq) anaphase-promoting complex subunit 4
  KO
K03351  anaphase-promoting complex subunit 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107515713 (ANAPC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107515713 (ANAPC4)
   04114 Oocyte meiosis
    107515713 (ANAPC4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107515713 (ANAPC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107515713 (ANAPC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107515713 (ANAPC4)
   03036 Chromosome and associated proteins [BR:ray03036]
    107515713 (ANAPC4)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107515713 (ANAPC4)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107515713 (ANAPC4)
SSDB
Motif
Pfam: ANAPC4 ANAPC4_WD40
Other DBs
NCBI-GeneID: 107515713
NCBI-ProteinID: XP_016010289
LinkDB
Position
Unknown
AA seq 807 aa
MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPP
NENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTV
ESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGG
SSGFIELYAYGMFKIARVTGIVGTCLALCLSSDLKSLSVVTEVSAGGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSV
QDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLL
YHLSELKGMASWKQKYEPLGLDAAGIEDAITAVGSFILKANELLQVIDSSMKNFKAFFRW
LYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVEKVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKP
ADVIGKSMNQAICIPLYRDARSQDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLHKMCI
LRRHTDISQSVSNGLTAIKFGSFTYATTEKVRRSTYSCLDAQFYDDETVTVVLKDTIGRE
GRDRLLVQLPLSLVYNCEDSAEYQFTGTYSTRLDEQCAAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEGSNKPVKIKEEVLSESE
AENQPAGAALAPEIVIKVEKLDPELDS
NT seq 2424 nt   +upstreamnt  +downstreamnt
atgttgcgttttccgacctgtttcccgtccttccgggtggtgggagagaagcagctgccg
caggagatcattttcctggtctggtcacccaagcgggatctcattgctttggccaacacc
gcgggcgaggttttgcttcatcgacttgcaagttttcatcgagtttggagttttccacca
aatgaaaatacaggaaaggaagtgacctgtctggcttggagaccagatggcaaacttttg
gcctttgctcttgctgacaccaagaaaattgttttgtgtgatgtagaaaaacccgaaagc
ttgcactccttttctgtggaggctccagtttcttgtatgcattggatggaagtgactgta
gaaagcagtgttctaacatccttttataatgctgaagatgaatcaaatcttctcttacct
aagctacctacattgcccaaaaattatagcaacacctcaaaaatatttagtgaagaaaat
tctgatgaaattattaagcttttgggagatgtaaggcttaatattcttgtccttggagga
agctctggttttattgaactttatgcttatggaatgttcaaaattgctcgagtcacaggg
attgttggtacttgtcttgcattgtgtttgtcaagtgatttgaaatcattatcagtggtc
acagaggtttctgccggtggtgcttcagaagtttcatactttcagctcgaaaccaatctg
ttgtactcttttttacccgaagtaactcggatggccagaaagtttactcacatttcagct
cttttacagtacataaacctatcactgacatgtatgtgtgaagcatgggaagagatacta
atgcagatggattctcgtctcaccaagtttgtgcaggaaaagaacacaactacatcagtg
caagatgaattcatgcacttgctcttgtgggggaaagcgagtgctgaacttcagaccctc
ttaatgaaccagttaacagtaaagggcttaaaaaagcttggccagtctatagagtcatca
tattccagtatacaaaaattggttataagtcacttacagagtggctcagagtctttatta
taccacttgagtgaactaaaaggaatggcttcatggaagcagaaatatgaacctcttgga
ctagatgctgcaggaattgaagatgctattactgctgtgggttctttcatactcaaggca
aatgaacttcttcaagttatagatagtagtatgaaaaacttcaaagcattttttcggtgg
ctttatgtggcaatgttgagaatgacagaagaccacgtacttcctgagctgaataagatg
actcaaaaagatatcacatttgttgctgaatttcttactgaacatttcaatgaggctcca
gacctttataatcgaaaaggaaaatacttcaatgttgaaaaagttggtcagtacttgaaa
gatgaagacgatgaccttgtgtcaccccctaacacagaaggaaatcagtggtatgacttc
cttcagaacagcagccaccttaaagaaagtcctttgctgtttccttattatcctcgaaaa
tcattgcattttgtgaaaaggcggatggagaacattattgatcaatgtttgcaaaagcca
gcagatgtaatcggaaaatcgatgaatcaagcaatctgtattccattatatagagatgct
agaagtcaggactctacacgtagattgttcaaatttccttttctgtggaataataaaact
tcaaatctacactatcttctttttactattttggaagattcacttcataaaatgtgtatc
ttaaggagacatactgatatttcccaatctgtaagtaatggactaactgctattaagttc
gggagcttcacatatgccacgactgagaaagtgagaagaagcacctacagttgcttagat
gcacagttttatgatgatgaaactgtaacggtagttcttaaagacactataggacgtgaa
ggaagagatagacttttggtccagctgccattgtctttggtatataactgtgaagattct
gcagagtatcagttcactgggacttactctacaaggctggatgagcagtgtgccgccatc
cccacacgtaccatgcacttcgagaaacattggagattactggaaagtatgaaagcgcag
tatgttgctgggaatggctttcgaaaagtatcctgtgtgttaagctcaaatctccggcat
gtgagagtattcgaaatggacatagatgatgaatgggagctggacgagtcttcagatgaa
gaggaggagggcagtaataagcctgtaaaaataaaggaagaggtgttgtccgagtcagag
gcggagaaccaaccagctggtgccgcgttagctccggagatagtcattaaggtggaaaaa
cttgaccctgagttagactcgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518724
Entry
107518724         CDS       T06036                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle protein 23 homolog
  KO
K03355  anaphase-promoting complex subunit 8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107518724 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107518724 (CDC23)
   04114 Oocyte meiosis
    107518724 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107518724 (CDC23)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107518724 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107518724 (CDC23)
   03036 Chromosome and associated proteins [BR:ray03036]
    107518724 (CDC23)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107518724 (CDC23)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107518724 (CDC23)
SSDB
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 TPR_16 ANAPC3 TPR_17 TPR_12 TPR_9 DUF772 TPR_15
Other DBs
NCBI-GeneID: 107518724
NCBI-ProteinID: XP_016016142
LinkDB
Position
Unknown
AA seq 597 aa
MAASPSVVPVALTTPVVPVLSGSSDFSNLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPSTEMPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggctgcgagcccttctgtagtccctgtggctctgacgactccagttgtacctgtcttg
tcagggagcagcgatttctcaaatttgcgggaaattaaaaagcaactgctgcttattgcc
ggccttacccgggagcggggcctactgcacagtagcaaatggtccgcggagttggccttc
tccctcccggcgttgcctctagccgagctgcagcctcctccgcctattacagaggaggat
gcccaggacatggatgcttataccctggccaaagcctactttgatgttaaagagtatgac
cgggcagcgcatttcctgcatggctgcaatagcaagaaagcttatttcctgtatatgtat
tctagatatctgtctggagaaaagaagaaggatgatgaaacagttgatagcctaggacct
ctggaaaaaggacaagtgaaaaatgaggctcttagagaattgagagtggagctcagcaaa
aaacaccaggctcgggaacttgatggatttggtctttatttatatggtgttgtgcttcga
aaactggacttggtgaaagaggccattgatgtattcgtggaggctactcatgttttgcct
ttgcattggggagcctggctagaactctgtaacttgataacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagtttttcctggctcatatatacacagag
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcattgatgtgggcttctct
aagagctcatatattgtttcccaaattgcagttgcctatcacaatatcagagatattgac
aaagccctctctatttttaatgagctaaggaaacaagacccttacaggattgaaaatatg
gacacattctccaaccttctttatgtcaggagcatgaaatctgagttaagttatctggct
cacaacctttgtgagattgataaatatcgtgtagaaacatgttgtgtaattggcaattat
tatagtttgcgttctcagcacgagaaagcagccttatatttccagagagccttgaaattg
aatcctcgctatcttggggcctggacattgatgggacatgagtacatggaaatgaagaac
acatctgctgctattcaggcttatagacatgccattgaggtcaataagcgagactacaga
gcctggtatggccttgggcagacctatgaaatccttaagatgccattttattgcctttat
tattacagacgggcccaccaacttcggcccaatgattctcgtatgctggttgctttagga
gaatgttatgaaaaactcaatcaactagtggaagccaaaaagtgttattggagagcttac
gctgtgggagatgtggagaaaatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaggctgcccaatgttacatcaaatatatccaagatatctattcctgc
ggggaaatagtggaacacttggaggaaagcactgcttttcgctatctggcccagtactat
tttaaatgcaagctgtgggatgaagcttcaacttgtgcccaaaagtgttgtgcattcaat
gatacccgggaagaaggtaaagccttgctccggcaaatcctgcagcttcggaaccaaggg
gagactccttccactgagatgcctgctccctttttcctccctgcttcactgtctgctaac
aacactcccacacgcagagtttctccactcaacctctcttcagtcacaccatag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520272
Entry
107520272         CDS       T06036                                 

Gene name
ANAPC11
Definition
(RefSeq) anaphase-promoting complex subunit 11
  KO
K03358  anaphase-promoting complex subunit 11
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107520272 (ANAPC11)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107520272 (ANAPC11)
   04114 Oocyte meiosis
    107520272 (ANAPC11)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107520272 (ANAPC11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107520272 (ANAPC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107520272 (ANAPC11)
   03036 Chromosome and associated proteins [BR:ray03036]
    107520272 (ANAPC11)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Ring finger protein
     107520272 (ANAPC11)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107520272 (ANAPC11)
SSDB
Motif
Pfam: zf-ANAPC11 zf-rbx1 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX
Other DBs
NCBI-GeneID: 107520272
NCBI-ProteinID: XP_016019338
LinkDB
Position
Unknown
AA seq 84 aa
MKVKIKCWNGVATWLWVANDENCGICRMAFNGCCPDCKVPGDDCPLVWGQCSHCFHMHCI
LKWLNAQQVQQHCPMCRQEWKFKE
NT seq 255 nt   +upstreamnt  +downstreamnt
atgaaggtgaagatcaagtgctggaacggcgtggctacttggctctgggtggccaacgac
gagaactgcggcatctgccggatggctttcaatggctgctgcccggactgcaaggtgccg
ggcgacgactgccccctggtgtggggccagtgctcgcactgcttccacatgcactgcatc
ctcaagtggctgaacgcgcagcaggtgcagcagcactgccccatgtgccgccaggagtgg
aagttcaaggagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520347
Entry
107520347         CDS       T06036                                 

Gene name
ANAPC10
Definition
(RefSeq) anaphase-promoting complex subunit 10 isoform X1
  KO
K03357  anaphase-promoting complex subunit 10
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04120  Ubiquitin mediated proteolysis
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    107520347 (ANAPC10)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107520347 (ANAPC10)
   04114 Oocyte meiosis
    107520347 (ANAPC10)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107520347 (ANAPC10)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107520347 (ANAPC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107520347 (ANAPC10)
   03036 Chromosome and associated proteins [BR:ray03036]
    107520347 (ANAPC10)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     107520347 (ANAPC10)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    107520347 (ANAPC10)
SSDB
Motif
Pfam: ANAPC10 F5_F8_type_C PITH
Other DBs
NCBI-GeneID: 107520347
NCBI-ProteinID: XP_016019518
LinkDB
Position
Unknown
AA seq 185 aa
MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQ
PHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWI
HVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMM
YRSIR
NT seq 558 nt   +upstreamnt  +downstreamnt
atgaccacaccaaacaagacacctcctggtgctgaccctaagcagttggaaaggactgga
acagtacgggagattgggtcacaagctgtttggtcactctcatcttgcaaaccaggattt
ggagtagatcaattacgagatgacaatctggaaacttactggcaatcagatggctcccaa
cctcatttagtgaacatccaattcagaagaaaaacaactgtgaagacattatgtatttat
gcagactacaaatctgatgaaagctatactccaagcaagatctcagtcagagtaggaaat
aatttccacaaccttcaagaaattcggcaacttgaattggtggaaccaagtggctggatt
cacgttcccttaactgataatcataagaagccaactcgcacattcatgatacagattgct
gttctagccaatcaccaaaatggaagagacacccacatgagacaaattaaaatatataca
ccagtggaagagagctccattggtaaatttcctagatgtacaactattgatttcatgatg
tatcgttcaataaggtga

DBGET integrated database retrieval system