KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500865
Entry
107500865         CDS       T06036                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04390  Hippo signaling pathway
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107500865 (FGF1)
   04014 Ras signaling pathway
    107500865 (FGF1)
   04015 Rap1 signaling pathway
    107500865 (FGF1)
   04390 Hippo signaling pathway
    107500865 (FGF1)
   04151 PI3K-Akt signaling pathway
    107500865 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107500865 (FGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107500865 (FGF1)
  09162 Cancer: specific types
   05226 Gastric cancer
    107500865 (FGF1)
   05218 Melanoma
    107500865 (FGF1)
   05224 Breast cancer
    107500865 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107500865 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107500865 (FGF1)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107500865 (FGF1)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   107500865 (FGF1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 107500865
NCBI-ProteinID: XP_015982024
LinkDB
Position
Unknown
AA seq 155 aa
MVDGKKSQGTNTTPFDGYKRRPERPSTILDMSDLGHKGVEEDERCLFTFAHVIFISVQLQ
LSAESVGEVYIKSTESGQYLAMDSDGLLYGSQTPDEDCLFLERLEENHYNTYTSKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggtagatgggaagaagtctcaggggactaacaccactccattcgatggctacaaaagg
agacctgaacgaccatccaccatcttggacatgtctgaccttggacacaagggagtcgaa
gaagatgagagatgtttatttacttttgctcatgttatttttatttcagttcagctgcag
ctcagtgcggaaagtgtgggggaggtgtatataaagagcaccgagagtggccagtacttg
gccatggactccgacgggcttttgtacggctcacagacaccagatgaggactgcttgttc
ctagaaaggctggaggaaaaccattacaacacctacacatccaagaagcacgcagaaaag
aattggtttgttgggctcaagaagaatgggagctgcaagcggggtcctcggactcactac
ggccagaaagcaatcctgtttctccccctgccagtgtcctctgactaa

DBGET integrated database retrieval system