KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500880
Entry
107500880         CDS       T06036                                 

Gene name
FZD1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107500880 (FZD1)
   04390 Hippo signaling pathway
    107500880 (FZD1)
   04150 mTOR signaling pathway
    107500880 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107500880 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107500880 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107500880 (FZD1)
   05205 Proteoglycans in cancer
    107500880 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107500880 (FZD1)
   05226 Gastric cancer
    107500880 (FZD1)
   05217 Basal cell carcinoma
    107500880 (FZD1)
   05224 Breast cancer
    107500880 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107500880 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    107500880 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107500880 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107500880 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107500880 (FZD1)
G protein-coupled receptors [BR:ray04030]
 Frizzled / Smoothened family
  107500880 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 107500880
NCBI-ProteinID: XP_015982093
LinkDB
Position
Unknown
AA seq 648 aa
MAEEEAPKKSRAAGGGASWELYAGALPAGPVTKGTWDAGSRRRRRRPPADSGRLARRLLL
LLWLLEAPLLLGVRAQAAGQGPGPGQQPPPPPPQQQQSGQQYNGERGISIPDHGYCQPIS
IPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVL
EQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTP
SLLPEFWTSNPQHGGGGHRGGGFSGGAGASERGKFSCPRALKVPSYLNYHFLGEKDCGAP
CEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLS
GCYTAVAVAYIAGFLLEDRVVCNDKFSEDGARTVAQGTKKEGCTILFMMLYFFSMASSIW
WVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGVCFV
GLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGV
FSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPMSPD
FTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggctgaggaggaggcgcctaagaagtcccgggccgccggtggcggcgcgagctgggaa
ctttatgccggggcgctcccggccgggccggtgacgaaggggacctgggacgcgggtagc
cgccgccgtcgccgccgccccccagctgactctggacgcttggcgcgcaggctgctgctg
ctgctttggctgctggaagctccgctgctgctgggggtccgggcacaggcggccggccag
gggcctgggccgggtcagcagcccccgccgccgccgcctcagcagcaacagagcgggcag
cagtacaacggcgagcggggtatctccatcccggaccatggctactgccagccaatttcc
atcccgctgtgcacggacatcgcgtacaaccagaccatcatgcccaacctgctgggccac
acgaaccaggaggatgcgggcctcgaggtgcaccagttctacccgctggtgaaggtgcag
tgctcggccgagctcaagttctttctgtgctccatgtacgcgccggtgtgcactgtgttg
gagcaggctctgccgccctgccgctctctctgcgagcgcgcgcgccagggctgcgaggca
ctcatgaacaagttcggcttccagtggccggacacgctcaagtgcgagaagttcccggtg
cacggcgccggcgagctgtgcgttggccagaacacgtcggacaagggcaccccgacaccc
tcgctgctgccggagttctggaccagcaacccccagcacggcggcgggggccaccgcggc
ggcggcttctctgggggtgcgggcgcgtcggagcgaggcaagttctcgtgcccgcgcgcc
ctcaaagtgccctcctacctcaactaccacttcctgggggagaaggactgcggcgcgccc
tgtgagcccaccaaggtgtacgggctcatgtactttgggcccgaagagctgcgcttctcg
cgcacctggatcggcatctggtcagtgctgtgctgcgcctccacgctcttcacggtgctc
acgtacctggtggacatgcggcgcttcagctaccccgagcggcccatcatctttctgtcg
gggtgctacacggccgtggcggtggcctacatcgccggcttcctgctggaggatcgggtg
gtgtgtaacgacaagttctccgaggacggggcgcgtacagtggctcagggcaccaagaag
gagggctgcaccatcctcttcatgatgctctacttcttcagcatggccagctccatctgg
tgggtgatcttgtcgctcacctggttcttggcggctggcatgaagtggggccacgaagcc
atcgaggcaaactcgcagtattttcacctggccgcctgggccgtgccggccatcaagacc
atcaccatcctggcgctgggccaggtggatggcgacgtgctgagtggggtgtgcttcgtg
gggctcaacaatgtggacgcgctgcgaggcttcgtgctggcgcccctcttcgtatacctg
ttcatcggtacgtcctttctgctcgccgggttcgtgtcgctcttccgcattcgtaccatc
atgaagcacgacggcaccaagacagagaagctggagaagctcatggtgcgcatcggcgtc
ttcagcgtgctttacacggtgccagccaccatagtcatcgcctgctacttctatgagcag
gccttccgggaccagtgggagcgcagctgggtggcccagagctgcaagagctacgctatc
ccctgcccccacctccaggcgggcggaggagccccgccgcacccgcccatgagccccgac
ttcacagtcttcatgatcaagtaccttatgacactgattgtgggcatcacgtcaggcttc
tggatctggtccggcaagaccctcaactcttggaggaagttctacaccagacttaccaac
agcaaacagggggagaccaccgtctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505121
Entry
107505121         CDS       T06036                                 

Gene name
FZD8
Definition
(RefSeq) frizzled-8
  KO
K02375  frizzled 5/8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107505121 (FZD8)
   04390 Hippo signaling pathway
    107505121 (FZD8)
   04150 mTOR signaling pathway
    107505121 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107505121 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107505121 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107505121 (FZD8)
   05205 Proteoglycans in cancer
    107505121 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107505121 (FZD8)
   05226 Gastric cancer
    107505121 (FZD8)
   05217 Basal cell carcinoma
    107505121 (FZD8)
   05224 Breast cancer
    107505121 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107505121 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    107505121 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107505121 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107505121 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107505121 (FZD8)
G protein-coupled receptors [BR:ray04030]
 Frizzled / Smoothened family
  107505121 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 107505121
NCBI-ProteinID: XP_015990466
LinkDB
Position
Unknown
AA seq 684 aa
MEWGYLLEVTSLLAALALLQRSSGAAAASTKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSQPRRLPPPPPGEQPPSGS
GHGRPPGARPPSRGRGGGGGDAAAPPTRGGGKARPPGGGAAPCEPGCQCRAPMVSVSSER
HPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDMER
FKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAAGAGDAGGAGGAAAGAGAAGA
GGPGGRGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGM
KWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLA
PLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVV
VACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSG
KTLESWRALCTRCCWASKGAAVGGGAGVSDTGGPGGGGSGGPGGCGGPGGGAGSLYSDVS
TGLTWRSGTASSVSYPKQMPLSQV
NT seq 2055 nt   +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgttgctggccgccttggcgctgctgcag
cgctccagcggtgctgcggccgcctcgaccaaggagttggcatgccaagagatcaccgtg
ccactgtgcaagggcatcggctacaactacacctacatgcccaaccagttcaaccacgac
acgcaggacgaggcgggcttggaggtgcaccagttctggccgctggtggagatccagtgc
tcgcctgacctcaagttcttcttgtgcagcatgtacactcccatctgcctggaggactac
aagaagcccttgcctccctgccgttcagtgtgcgagcgcgccaaggccggatgtgcgccc
ctcatgcgccagtacggcttcgcctggccggaccgcatgcgctgcgaccggctgccagaa
cagggcaaccccgacacgctatgcatggactacaaccgcaccgacctcaccacggctgcg
cccagccagccgcgacgcctgccgccgccacctcccggcgaacagccgccctccggcagc
ggccacggccgcccgcccggggctaggcccccgtcccgaggcaggggcgggggtggcggg
gacgcggcggcgccccctacgcgcggcggcgggaaggcacggccccctggcggaggcgcg
gcgccctgtgagcctggctgccagtgccgcgcgcccatggtgagcgtgtccagcgagcga
cacccgctctataaccgcgtgaagaccggccagatcgccaactgcgcgctgccctgccac
aatcccttcttcagccaggacgagcgggccttcaccgtcttctggatcggactgtggtct
gtgctctgctttgtgtccaccttcgccactgtgtccaccttcctcatcgacatggagcgc
ttcaagtacccagagcggcctatcatcttcctctcagcctgctacctcttcgtgtcagtc
ggctacctggtacgcctggtggcgggccacgagaaggtggcgtgtagtggtggcgcggca
ggagcgggcgacgcgggcggcgcaggcggcgcggcggcgggcgcaggtgcggcgggcgcg
ggcggcccaggtgggcgcggtgagtacgaagagctgggcgccgtggagcagcacgtgcgc
tacgagactacggggcccgctctgtgcaccgtggtcttcctgcttgtctacttcttcggc
atggccagctccatctggtgggtgatcctatcgctcacgtggttcttggcggctggcatg
aaatggggcaacgaagccattgctggctactcacaatacttccacctggctgcgtggctc
gtgcccagtgtcaagtccatcgccgtgctggcgctcagctccgtggatggagacccggtg
gcaggcatctgctacgtgggcaaccagagtctcgacaacctgcgcggctttgtgctggcg
ccgctggttatctacctcttcatcggcaccatgttcctactggctggcttcgtgtcactc
tttcgcatccgctcagtcatcaagcagcagggaggccccaccaagacgcacaagctggag
aagctcatgatccgcctgggcctcttcacagtgctctacacagtgcccgccgccgtcgtg
gtcgcctgcctcttctacgagcagcacaaccgcccgcgttgggaggccacgcacaactgc
ccttgtctgcgggacctgcagccggaccaggcgcgccggcctgactatgctgtcttcatg
ctcaagtatttcatgtgcctggtcgtgggcatcacctcaggcgtgtgggtctggtcaggc
aagacgctcgagtcttggagggccctgtgcacccgctgctgctgggccagcaagggcgcc
gcggtgggcggcggcgcgggtgtgagtgacaccggcggacccgggggcggcgggagtggg
ggtcccggggggtgcggcgggccgggcggaggggcgggctcactctacagcgacgtcagc
accggtttgacgtggcggtctggcacggccagctctgtgtcttacccaaagcaaatgcca
ttgtcccaggtctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505167
Entry
107505167         CDS       T06036                                 

Gene name
FZD5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107505167 (FZD5)
   04390 Hippo signaling pathway
    107505167 (FZD5)
   04150 mTOR signaling pathway
    107505167 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107505167 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107505167 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107505167 (FZD5)
   05205 Proteoglycans in cancer
    107505167 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107505167 (FZD5)
   05226 Gastric cancer
    107505167 (FZD5)
   05217 Basal cell carcinoma
    107505167 (FZD5)
   05224 Breast cancer
    107505167 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107505167 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    107505167 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107505167 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107505167 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107505167 (FZD5)
G protein-coupled receptors [BR:ray04030]
 Frizzled / Smoothened family
  107505167 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 107505167
NCBI-ProteinID: XP_015990527
LinkDB
Position
Unknown
AA seq 586 aa
MARSDPSAPPSLLLLLLAQLAGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQ
DEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLM
RQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPTKATLPGPPGGPSSGG
ECAAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIG
LWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSR
EHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYF
HLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLL
AGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEA
ALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCR
RRRGHKSGGATAAGDYAEASAALTGRTGPPGPAAAAYHKQVSLSHV
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggctcggtctgacccgtctgcgccgccctcgctgctgctgctgctcctggcgcagctg
gcgggccgggcggcggccgcctccaaggccccagtgtgccaggaaatcacggtacccatg
tgccgcggcatcggctacaacctgacgcacatgcccaaccagtttaaccacgacacgcag
gacgaggcgggcttggaggtgcaccagttctggccactggtggagatacactgctctccg
gacctgcgcttcttcctgtgctccatgtacacgcccatctgcctgcccgactatcacaag
cccctgcctccttgccgctcggtgtgcgagcgcgccaaggccggctgctcgccgctcatg
cgccagtatggcttcgcctggccggagcgcatgagctgtgaccgcctcccagtactgggc
cgcgacgccgaggtcctgtgcatggattacaaccgcagcgaggccaccacggcgcccccg
aggcccttccctaccaaggctaccctcccaggcccgccaggggggccatcctcagggggc
gagtgcgccgctggggggccgtcggtgtgcaagtgccgcgaacccttcgtgcccatcctg
aaggagtctcatccgctctacaacaaggtgcggacaggccaggtacccaactgcgcggtt
ccctgctaccagccctccttcagcccggacgagcgcacgttcgccaccttctggatcggc
ctgtggtctgtgctgtgcttcatctccacctccaccacggtggccaccttcctaatagac
atggaacgcttccgctaccccgagcgccccatcatcttcctgtcagcctgctacttgtgc
gtatcactgggcttcctggtgcgcctggtcgtgggccatgccagcgtcgcctgtagccga
gagcacagccacattcactacgagaccacgggccctgcgctgtgcactgttgtcttccta
ctggtctactttttcggcatggccagctccatctggtgggtcatcctgtcgctcacctgg
ttcttggcagctggcatgaagtggggcaatgaggccatcgccggctatgcgcagtacttc
cacttggctgcgtggctcatccccagtgtcaagtccatcaccgcgctggcactgagctcc
gtggatggagatccggtggctggcatctgctacgtgggcaaccagaacttgaactccctg
cgcggctttgtgctgggtcctctggtgctctacctgctggtgggcacactcttcctcctg
gcaggcttcgtgtcgctcttccgcatccgtagtgtcataaagcagggcggcaccaagaca
gacaagctggagaagctcatgatccgcatcggcatcttcacgctgctctacacggtgccg
gccagcattgtggtggcctgctacctgtacgagcagcactatcgcgagagctgggaggct
gcgctcacctgcgcgtgcccgggccccgacgctggccagccgcgcgccaagcccgagtac
tgggtgctcatgcttaagtacttcatgtgcctcgtggtgggcatcacgtcgggcgtctgg
atttggtccggcaagactgtggagtcgtggcggcgcttcaccagccgctgctgctgccgc
cggcgacggggtcataagagcggtggtgccacggctgctggggactatgccgaggcgagc
gcagcgctcacgggcaggactgggccgccgggccctgccgcagccgcttaccacaagcag
gtgtccttgtcgcacgtgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508108
Entry
107508108         CDS       T06036                                 

Gene name
FZD2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107508108 (FZD2)
   04390 Hippo signaling pathway
    107508108 (FZD2)
   04150 mTOR signaling pathway
    107508108 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107508108 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107508108 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107508108 (FZD2)
   05205 Proteoglycans in cancer
    107508108 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107508108 (FZD2)
   05226 Gastric cancer
    107508108 (FZD2)
   05217 Basal cell carcinoma
    107508108 (FZD2)
   05224 Breast cancer
    107508108 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107508108 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    107508108 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107508108 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107508108 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107508108 (FZD2)
G protein-coupled receptors [BR:ray04030]
 Frizzled / Smoothened family
  107508108 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 107508108
NCBI-ProteinID: XP_015995124
LinkDB
Position
Unknown
AA seq 565 aa
MRPRSALPRLLLPLLLLPTAGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNL
LGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQG
CEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPALLTTAPPPGLQPGAGGTP
GGPGGGGSPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEE
TRFARLWILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVL
QERVVCNERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKW
GHEAIEANSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPL
FVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACY
FYEQAFREHWERSWVSQHCKSLAIPCPVHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIW
SGKTLHSWRKFYTRLTNSRHGETTV
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgcggccccgcagcgccctgccccgcctgctgctaccgctgctgctgctgcccaccgcc
gggccggcccagttccacggggagaagggcatctccatcccggaccacggcttctgccag
cccatctccatcccgctgtgcacagacatcgcctacaaccagaccatcatgcccaacctt
ctgggccatacgaaccaggaggacgctggcctggaagtgcaccagttctacccgttggta
aaagtgcagtgctcgcccgaactgcgcttcttcctgtgctccatgtacgcacccgtgtgc
accgtgctggagcaggccattcctccgtgccgctccatctgcgagcgcgcgcgccagggc
tgcgaagcactcatgaacaagttcggattccagtggcccgagcgcctgcgctgcgagcac
ttcccgcgccacggtgcggagcagatctgcgtgggccagaaccactccgaggacggcgcg
ccggcgctgctcaccaccgcgccgcctcccggcctgcagccaggtgctggaggcaccccg
ggcggcccaggcggcggcggctcgcccccgcgttacgccacgctggagcacccgttccac
tgccctcgcgtccttaaggtgccgtcctatctgagctacaagttcctgggcgagcgcgac
tgcgcggcgccctgcgagccggcgcggccggacggctctatgttcttctcgcaggaagag
acgcgcttcgcgcgcctctggatcctcacctggtcggtgctgtgctgcgcctccaccttc
ttcaccgtcaccacgtacctggtggatatgcagcgcttccgctaccccgagaggcccatc
atcttcctgtccggctgctacactatggtgtcggtggcctacatcgcgggcttcgtactc
caggagcgtgtggtgtgcaacgaacgcttctcagaggacggttaccgcacggtggtgcag
ggcaccaagaaggagggctgcaccattctcttcatgatgctgtacttcttcagcatggcc
agttccatctggtgggtcatcctgtcgctcacctggttcctggcggcgggcatgaagtgg
ggccacgaggccatcgaggccaactcgcagtactttcacctggccgcgtgggccgtgccg
gcggtcaagactatcactatcctggccatgggccagattgacggcgacctgctgagcggc
gtgtgcttcgtgggcctcaacagcctggacccgctgcggggcttcgtgctggcgccgctc
ttcgtgtacctgttcataggcacgtccttcctcttggccggtttcgtgtcactcttccgc
atccgtaccatcatgaagcacgacggcaccaagaccgagaagctagagcggcttatggtg
cgcatcggcgtcttctcggtgctctacacggtgcccgccaccattgtcatcgcctgctac
ttctatgagcaggcctttcgagagcactgggagcgctcgtgggtgagccagcactgcaag
agcctggccatcccgtgcccggtgcactacacgccgcgcatgtcgcccgacttcaccgtc
tacatgatcaaatacctcatgacgctcatcgtgggcatcacgtcgggcttctggatctgg
tccggcaagacgctgcactcgtggaggaagttctacacgcgtcttaccaacagccggcac
ggcgagaccaccgtgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510778
Entry
107510778         CDS       T06036                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3 isoform X1
  KO
K02329  frizzled 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107510778 (FZD3)
   04390 Hippo signaling pathway
    107510778 (FZD3)
   04150 mTOR signaling pathway
    107510778 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107510778 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107510778 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    107510778 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107510778 (FZD3)
   05206 MicroRNAs in cancer
    107510778 (FZD3)
   05205 Proteoglycans in cancer
    107510778 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107510778 (FZD3)
   05226 Gastric cancer
    107510778 (FZD3)
   05217 Basal cell carcinoma
    107510778 (FZD3)
   05224 Breast cancer
    107510778 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107510778 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    107510778 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107510778 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107510778 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107510778 (FZD3)
G protein-coupled receptors [BR:ray04030]
 Frizzled / Smoothened family
  107510778 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 107510778
NCBI-ProteinID: XP_016000146
LinkDB
Position
Unknown
AA seq 666 aa
MAMSWIVFYLWPLTMFAEHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSQDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASNPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTHMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgagttggattgtcttctatctttggcccttgactatgtttgcggagcatata
ggtgggcacagtttgttttcttgtgaacctattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcattatgaccaacagacagcagcttta
gcaatggagccattccaccctatggtgaatctggattgttctcaggatttccggccattt
ctttgtgcactctatgctcctatttgtatggagtatggacgtgtcacacttccctgtcgt
aggctgtgtcagcgggcttacagcgagtgttcaaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccataccctcgactt
gtggatctgaatttagctggagatcctactgaaggagccccagtggcagtgcagagggac
tatggtttttggtgtccccgagagttgaaaattgatcctgatcttggttattcttttttg
cacgtgcgtgattgttcacctccttgtccaaacatgtactttaggagagaagaactttca
tttgctcgctatttcataggattgatttcaatcatttgcctctctgccacgttgtttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaagacctatcatattt
tatgcagtctgctacatgatggtatcattaattttcttcattgggtttttgcttgaggac
cgagtagcctgcaatgcatctaacccagcacagtataaggcttccacagtgacacaagga
tctcataataaagcgtgtaccatgctttttatggtactctatttttttactatggctggc
agcgtttggtgggtaatccttaccatcacatggttcttggcagctgtgccaaagtggggt
agtgaagctattgagaagaaagcattgctgtttcacgccagtgcatggggcatccctgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgttttgttggcctctacgatgttgatgcattaagatattttgttcttgcacccctctgc
ctgtatgtggtagtaggggtttcgctcctcttagccggcattatatccctaaacagagtt
cgaattgagattccattagaaaaggagaaccaagataaattggtgaagtttatgatccgg
attggtgttttcagcattctttatctcgtaccactcttggttgtaattggatgctacttt
tatgaacaagcttaccgtggcatctgggaaacaacatggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggtcactcacatgagtcgtccggatctgattctcttt
ctgatgaaatacctgatggctctcatagttggtattccctccattttttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactccaagaacctgattttgctcagtccctcctgagggatcca
aatactcctattataagaaaatcaaggggaacttctactcaaggaacatccacacatgct
tcttctactcagctggctatggtggatgatcagaggagcaaagcagggagtgtccacagc
aaagtgagcagctaccatggcagcctccacaggtcccgtgatggcaggtacactccctgc
agttacagaggaatggaagagagactacctcatggcagcatgtcacgactaacagatcac
tccaggcacagtagttctcatcggctcaatgaacagtcacgacatagcagcatccgagat
ctcagtaataatcctatgactcacatcacacatggcaccagcatgaatcgagtaattgaa
gaagatggaaccagtgcttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511534
Entry
107511534         CDS       T06036                                 

Gene name
FZD10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107511534 (FZD10)
   04390 Hippo signaling pathway
    107511534 (FZD10)
   04150 mTOR signaling pathway
    107511534 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107511534 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107511534 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511534 (FZD10)
   05205 Proteoglycans in cancer
    107511534 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107511534 (FZD10)
   05226 Gastric cancer
    107511534 (FZD10)
   05217 Basal cell carcinoma
    107511534 (FZD10)
   05224 Breast cancer
    107511534 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107511534 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    107511534 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107511534 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107511534 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107511534 (FZD10)
   04090 CD molecules [BR:ray04090]
    107511534 (FZD10)
G protein-coupled receptors [BR:ray04030]
 Frizzled / Smoothened family
  107511534 (FZD10)
CD molecules [BR:ray04090]
 Proteins
  107511534 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 107511534
NCBI-ProteinID: XP_016001462
LinkDB
Position
Unknown
AA seq 581 aa
MPRPGPRLWLALQVMGACAAISSMDMERPGDGRCQPIEIPMCRDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPARSPGLFAPPPRPQRPPGAQEH
QPKEGGAGRAGCANPGKFHHVEKSASCAPLCTPGVDVYWSHDDKRFAVVWLAVWSVLCFF
SSAFTVLTFLIDPDRFRYPERPIIFLSMCYCVSSLGYIIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLVPLACYLVLGTSFILSGFAAL
FHIRRVMKTGGENTDKLEKLMARIGLFSVLYTVPATCAIACYFYERLNMEYWKALATQHK
CRVDNQTKTADCLMGASIPAVEVFLVKIFMLLVVGITSGMWVWTSKTLQSWQLVCGRRFK
KKSGRKPASVVAHSGIYKKAQHPQKTYPGKHEIPAPSPTCV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgccgcgcccgggcccgcgcctgtggctggccctgcaggtgatgggggcgtgcgccgcc
atcagctccatggacatggagcgcccgggggacggcaggtgccagcccatcgagatcccg
atgtgcagagacatcggctacaacatgacccgcatgcccaacctcatgggccacgagaac
cagcgcgaggccgccatccagctgcacgagttcgcgccgctcgtggagtacggctgccac
ggccacctgcgcttcttcctgtgctcgctctacgcgcccatgtgcaccgagcaggtctcc
acgcccatccccgcctgccgcgtcatgtgcgagcaggcccggctcaagtgctccccgatc
atggagcagttcaacttcaagtggcccgactcgctggactgcagcaaactccccaacaag
aacgaccccaactacctgtgcatggaggcgcccaacaacggctcggacgagccggcgcgc
agccccggcctcttcgcgccgccgccgcgcccgcagcggccccccggcgcgcaggagcac
cagccgaaggaggggggcgcggggcgcgccggctgcgccaaccccggcaagttccaccac
gtggagaagagcgcgtcgtgcgcgccgctgtgcacgcccggcgtggacgtgtactggagc
cacgacgacaagcgcttcgccgtggtctggctggccgtgtggtccgtgctctgcttcttc
tccagcgccttcaccgtcctcaccttcctcatcgaccccgaccgcttccgctaccccgag
cgccccatcatcttcctgtccatgtgctactgcgtgtcctcactgggctacatcatccgc
ctgttcgccggtgccgagagcatcgcgtgcgaccgggacagcgggcagctctacgtcatc
caggagggcctggagagcaccggctgcacgctcgtcttcctggtgctctactacttcggc
atggccagctcgctctggtgggtggtcctcacgctcacctggttcctggccgccggcaag
aagtggggccacgaggccatcgaggccaacagcagctacttccacctggcggcctgggcc
atcccggcggtgaagaccatcctgatcctggtcatgcgcagggtggcgggcgacgagctc
accggcgtctgctacgtgggcagcatggacgtgaacgcgctcacgggcttcgtgctcgtc
cccctggcctgctacctcgtcctcggcacgtccttcatcctctcgggcttcgcggccctt
ttccacatccgcagggtgatgaagacgggcggggagaacacggacaaactggagaagctc
atggcgcggatcgggctcttctccgtgctgtacacggtgcccgccacctgcgccatcgcc
tgctacttctacgagcgcctcaacatggagtactggaaagcgctggccacgcagcacaag
tgccgcgtggacaaccagaccaagacggcggactgcctgatgggggcgtccatccctgcc
gtggaggtcttcctggtgaagatcttcatgctgctggtggtgggcatcaccagcggcatg
tgggtctggacgtccaagacgctgcagtcctggcagctcgtgtgcggccgcaggttcaag
aagaagagcggaaggaaacccgccagcgtcgtcgcccacagcgggatttacaaaaaagcc
cagcatccccagaaaacgtacccggggaaacacgaaatccccgcgccgtcccccacctgc
gtgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511767
Entry
107511767         CDS       T06036                                 

Gene name
FZD9
Definition
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107511767 (FZD9)
   04390 Hippo signaling pathway
    107511767 (FZD9)
   04150 mTOR signaling pathway
    107511767 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107511767 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107511767 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511767 (FZD9)
   05205 Proteoglycans in cancer
    107511767 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107511767 (FZD9)
   05226 Gastric cancer
    107511767 (FZD9)
   05217 Basal cell carcinoma
    107511767 (FZD9)
   05224 Breast cancer
    107511767 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107511767 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    107511767 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107511767 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107511767 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107511767 (FZD9)
   04090 CD molecules [BR:ray04090]
    107511767 (FZD9)
G protein-coupled receptors [BR:ray04030]
 Frizzled / Smoothened family
  107511767 (FZD9)
CD molecules [BR:ray04090]
 Proteins
  107511767 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 107511767
NCBI-ProteinID: XP_016001972
LinkDB
Position
Unknown
AA seq 591 aa
MAVLPLRRALLLWQLLAAGGAALEIGRFDPERGRGPAPCQAVEIPMCRGIGYNLTRMPNL
LGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPIPACRPMCEQARL
RCAPIMEQFNFGWPDSLDCARLPTRNDPHALCMEAPENATVGPAEPHKGLGMLPVAPRPA
RPPGDAALDPGGGGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDFALVWMAVWSA
LCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNVYSLAFLIRAVAGAQSVACDQEAGA
LYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTLTWFLAAGKKWGHEAIEAHGSYFHM
AAWGLPALKTIVILTLRKVAGDELTGLCYVANMDAAALTGFVLVPLSCYLVLGTSFLLTG
FVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYTVPATCVIVCYVYERLNMDFWRLQA
TEQPCSPASMPGGRRDCSLQGGSVPTVAVFMLKIFMSLVVGITSGVWVWSSKTFQTWQSL
CHRKMAAGRARAKACRAPGGYGRGTHCHYKAPTVVLHMTKTDPSLENPTHL
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggccgtgctgccgctccgccgagcgctgctgctgtggcagctgctggcggcgggcggt
gcggctctggagatcggccgctttgacccggagcgcgggcgcgggccagctccgtgccag
gcggtggagatccccatgtgccgcggcatcggctacaacctgacccgcatgcccaacctg
ctgggccacacgtcgcagggcgaggcggcggcggagctggccgagtttgctccgctcgtg
cagtacggctgccacagccacctgcgcttcttcctgtgctcgctctacgcacccatgtgc
acggaccaggtctcgacgcccatccctgcctgccggcccatgtgcgagcaggcgcgcctg
cgctgcgcgcccatcatggagcagttcaacttcggctggccggactccctggactgcgcc
aggctgcccacccgcaacgacccgcacgcgctctgcatggaggcgcccgagaacgccacg
gtcggccccgcagagccccacaaaggcctaggcatgctgcccgtggcaccgcggcccgca
cggccccccggagacgcagccctggacccgggcggcggcggcacttgcgagaaccccgaa
aagttccagtacgtggaaaagagccgctcgtgcgcgccgcgctgcgggccgggtgtcgag
gtgttctggtctcggcgcgacaaggacttcgcactcgtctggatggccgtgtggtcagcg
ctttgcttcttctctactgccttcactgtactcaccttcctgctggagcctcaccgcttc
cagtaccccgagcgccccatcatcttcctctctatgtgctacaacgtctactcgctggcc
ttcctcatccgcgctgtggccggggctcagagtgttgcctgcgaccaggaggcaggtgcg
ctctacgtgatccaagagggcctggagaacacgggctgcaccctcgtcttcttgctgctc
tactacttcggcatggccagctcgctgtggtgggtagtgctgacactcacctggttcctg
gcggccggcaagaaatggggccatgaggccattgaggcccatggcagctacttccacatg
gcagcctggggcctgccggccctcaagaccattgttatcctgacgctgcgcaaggtggct
ggggatgagctgaccgggctctgctacgtggccaacatggacgcagccgcactcacgggc
tttgtgctggtgcccctctcctgctatttggtactgggtaccagcttcctcctgaccggc
ttcgtggccctcttccacatacgcaagatcatgaagacagggggcaccaacacagagaag
ctagagaagctcatggtcaagattggggtcttctccatcctgtacacagtgcctgccact
tgcgtcattgtgtgctatgtctatgaacgcctcaacatggacttctggcgccttcaggcc
acagagcaaccatgctccccagccagcatgcccggtggccggagggactgctcgctgcaa
gggggctcagtgcccacagtagccgtctttatgctcaaaatcttcatgtcactggtggtg
ggtattaccagcggtgtctgggtatggagctccaagactttccagacctggcagagccta
tgccaccgcaagatggcagctggtcgggcccgggcaaaggcctgccgggcccctgggggc
tatggccgtggcacccactgccattataaggcccccactgtggtcttgcacatgactaag
acggacccctctctggagaaccccacacacctctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512212
Entry
107512212         CDS       T06036                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6
  KO
K02376  frizzled 6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107512212 (FZD6)
   04390 Hippo signaling pathway
    107512212 (FZD6)
   04150 mTOR signaling pathway
    107512212 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107512212 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107512212 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107512212 (FZD6)
   05205 Proteoglycans in cancer
    107512212 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107512212 (FZD6)
   05226 Gastric cancer
    107512212 (FZD6)
   05217 Basal cell carcinoma
    107512212 (FZD6)
   05224 Breast cancer
    107512212 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107512212 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    107512212 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107512212 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107512212 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107512212 (FZD6)
G protein-coupled receptors [BR:ray04030]
 Frizzled / Smoothened family
  107512212 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec RseC_MucC Integrin_alpha
Other DBs
NCBI-GeneID: 107512212
NCBI-ProteinID: XP_016002994
LinkDB
Position
Unknown
AA seq 712 aa
MEMFIFLWTCVFLPLIRGHSLFTCEPIIVPRCMKMAYNMTFFPNLMGHYDQSTAAVEMEL
FLPLANLECSPNVETFLCKAFVPTCTEQIHVVPPCRKFCEKVYSDCKKLIDTFGIQWPEE
LKCDRLQYCDEAVPVTFDPHTEFLGPQKKTEQIQRDIGIWCPRHLKTTGAQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVKRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGNSTACNKADEKLEVGDTVVLGSQNKACSVLFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGIPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKTETRPELAVFMIKY
LMTLIVGISPVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGASANHGTSTVAITSHDYLGQETFTEIQTSPETSVREG
REDGVSAPTSGEQDRGDPASSAVSSSKLCGEQADRKGRAGNMSDKGSVSDSARGEGRVTP
KSDVTETGLVQSNNLHVPSSSEPSSLKGSTSLLVHSASGVRKEQGASGHSDT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggaaatgttcatatttttgtggacatgtgtttttctacccctcataagagggcacagt
cttttcacctgtgaaccaattattgttcccagatgtatgaaaatggcctacaacatgaca
tttttccctaatctgatggggcattatgaccagagtaccgctgctgtagaaatggagctt
tttcttccccttgcaaacctggaatgttcaccaaatgttgaaactttcctttgcaaagct
tttgtaccaacatgcacagagcaaattcatgtggttccaccttgtcgtaaattttgtgag
aaagtatattctgactgcaaaaaattaattgacacttttgggatccaatggcctgaggaa
cttaaatgtgacagattacaatactgtgatgaggctgttcctgtaacttttgatccacat
acagagtttcttggtcctcagaagaaaacagaacaaatccaaagagacattggaatttgg
tgtccaaggcatcttaagactactggggcacaaggctataagtttctcggaattgaccaa
tgtgcacctccgtgtcccaacatgtattttaaaagtgatgagctagagtttgcgaaaagt
tttatcggaatagtttcaatattttgtctttgtgcaactctgttcacattccttactttt
ttaattgatgttaaaagattcagatacccagagagaccaattatatattactctgtctgt
tacagcattgtatctcttatgtactttattggatttttgctaggcaatagcacagcctgc
aataaggccgatgagaagctagaagttggggatacagttgttcttggctcccaaaataag
gcttgctctgttttgtttatgtttttgtattttttcacaatggctggcactgtgtggtgg
gtgattcttaccattacttggttcttagctgcaggaagaaaatggagttgtgaagccatt
gaacaaaaagctgtgtggtttcatgcggtagcatggggaattccaggttttctgactgtt
atgcttcttgctatgaacaaagtcgagggagacaacattagtggagtttgctttgtcggc
ctttatgacctggatgcttctcgttactttgtactcttgccactgtgcctttgtgtgttt
gtcgggctgtctcttcttttagctggcattatttccttaaatcatgttcgacaagttata
cagcatgatggtcggaaccaagagaaactaaagaaatttatgattcgaattggagtcttc
agtggcctgtatctcgtgccattagtgacacttcttggatgttatgtctatgaacaagtg
aacaggattacctgggagataacttgggtctctgaccattgtcgtcagtaccacatccca
tgtccttatcaggcaaaaacagaaactcggccagagttggctgtatttatgataaaatat
ctgatgacattaatcgttggcatctctcccgtcttctgggttggaagcaaaaagacatgc
acagaatgggctgggttttttaaacgaaatcgcaagagagatcccatcagtgaaagtcga
agagtactacaggagtcatgtgagtttttcttaaagcataattctaaagttaagcacaaa
aagaagcactacaaacctagttcgcataagctgaaggtcatttccaaatccatggggacc
agcacaggagcttcagcgaatcacggcacttccacagtagccatcactagccacgattac
ttaggacaagaaactttcacggaaatccaaacctctccagaaacgtcagtgagggaaggg
agagaagacggagtgagtgcccccacatcaggagaacaggaccgcggcgaccctgcctcc
tcagcagtgtccagttccaaactctgtggggaacaggccgacaggaaaggccgggcaggc
aacatgagcgataagggcagtgtgtctgacagtgcgcggggtgaaggaagggtcactcca
aaaagtgacgttactgaaactggcctggtgcagagcaacaacttgcatgtccccagttct
tcagagccaagcagcctgaaaggctccacatcactgctcgttcactcggcttcaggagtt
agaaaagagcagggcgccagcggtcactcagatacctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518567
Entry
107518567         CDS       T06036                                 

Gene name
FZD4
Definition
(RefSeq) frizzled-4
  KO
K02354  frizzled 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107518567 (FZD4)
   04390 Hippo signaling pathway
    107518567 (FZD4)
   04150 mTOR signaling pathway
    107518567 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107518567 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107518567 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518567 (FZD4)
   05205 Proteoglycans in cancer
    107518567 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107518567 (FZD4)
   05226 Gastric cancer
    107518567 (FZD4)
   05217 Basal cell carcinoma
    107518567 (FZD4)
   05224 Breast cancer
    107518567 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107518567 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    107518567 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107518567 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107518567 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107518567 (FZD4)
   04090 CD molecules [BR:ray04090]
    107518567 (FZD4)
G protein-coupled receptors [BR:ray04030]
 Frizzled / Smoothened family
  107518567 (FZD4)
CD molecules [BR:ray04090]
 Proteins
  107518567 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 107518567
NCBI-ProteinID: XP_016015884
LinkDB
Position
Unknown
AA seq 538 aa
MAWRGAGPSVLGAPGGVGLSLRLLLLLLLLLLGPAWGFGDEEERRCDPIRISMCQNLGYN
VTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGG
MCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGE
ECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTAFTVL
TFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKN
TGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKT
IVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSN
LQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRFSADDSNMAVEML
KIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1617 nt   +upstreamnt  +downstreamnt
atggcctggcggggcgcaggaccgagcgtcttgggggcgcccgggggcgtcggtctcagt
ctgcggctgctgctgctgttgctgctgctgctcttgggaccagcttggggtttcggggac
gaggaggagcggcgctgcgaccccatccgcatctccatgtgccagaacctgggctacaac
gtgaccaagatgcccaatttggtggggcacgagctgcagaccgacgccgagctgcagctg
acaactttcacgccgcttatccagtacggctgctccagccagctgcagttcttcctttgt
tctgtgtatgtgccaatgtgcacagagaagatcaacatccccataggcccatgcggtggc
atgtgtctttcagtcaagagacgctgtgaacctgtcctgaaggaatttggatttgcttgg
ccagagagcctgaactgcagcaaatttccaccacagaatgaccacaaccacatgtgcatg
gaagggccaggtgacgaggaggtgccgttacctcacaaaacccccatccaacctggggaa
gagtgtcattctgtgggaaccaattccgatcagtacatctgggtgaaaaggagcctgaac
tgcgttctcaagtgtggctacgatgctggcttatatagccgctcggccaaggagttcacc
gatatctggatggccgtgtgggccagcctatgcttcatctccactgccttcacagtgctg
accttcctgatcgattcttccaggttttcctaccctgagcgccccatcatatttctcagt
atgtgctataatatttatagcattgcttatattgtcaggctgactgtaggccgggaaagg
atatcctgcgattttgaagaggcagcagaacctgttctcatccaagaaggacttaagaac
acaggatgtgcaatcattttcttgttgatgtacttttttggaatggccagttccatctgg
tgggttattctgacactcacttggtttttggcagcaggactcaaatggggtcatgaagcc
attgaaatgcacagctcttatttccacattgcagcctgggccatccctgcagtgaaaact
attgtcatcttgattatgagactggtagatgcagatgaactcactggcctgtgctatgtt
gggaaccaaaaccttgatgccctcacaggctttgtggtggctcctctcttcacttactta
gtgatcggaactttgttcattgctgcaggtttggtggccttgttcaaaattcgatcaaat
cttcaaaaagatgggacaaagacagacaagttggaaagactgatggtcaaaattggagtc
ttctctgtcctgtacacggttcctgcaacctgtgtgattgcctgttatttctatgaaatc
tccaactgggcgctcttccggttttctgcagatgactccaatatggcagttgaaatgttg
aaaatttttatgtctttgctggtgggcatcacttcaggcatgtggatttggtctgccaaa
actcttcacacatggcagaagtgttccaacagattggtgaattctgggaaggtaaagaga
gaaaagagggggaatggttgggtaaagcctgggaaaggcaatgaaactgttgtataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519374
Entry
107519374         CDS       T06036                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04150  mTOR signaling pathway
ray04310  Wnt signaling pathway
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04916  Melanogenesis
ray04934  Cushing syndrome
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05165  Human papillomavirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107519374 (FZD7)
   04390 Hippo signaling pathway
    107519374 (FZD7)
   04150 mTOR signaling pathway
    107519374 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107519374 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107519374 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519374 (FZD7)
   05205 Proteoglycans in cancer
    107519374 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107519374 (FZD7)
   05226 Gastric cancer
    107519374 (FZD7)
   05217 Basal cell carcinoma
    107519374 (FZD7)
   05224 Breast cancer
    107519374 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107519374 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    107519374 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107519374 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107519374 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107519374 (FZD7)
G protein-coupled receptors [BR:ray04030]
 Frizzled / Smoothened family
  107519374 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 107519374
NCBI-ProteinID: XP_016017449
LinkDB
Position
Unknown
AA seq 574 aa
MRGPGAAASRLRVGLCTLVLTLLGALPAITGAQPYHGEKGISVPDHGFCQLISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDKAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGGPTAYP
TAPYMPDLPFTAVPPGAADGRVRSAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1725 nt   +upstreamnt  +downstreamnt
atgcggggccctggcgcggccgcgtcgcgcttgcgggtgggcctatgcaccctggtgctt
acgctgctgggagcgctgcctgcgatcaccggcgcgcagccgtatcacggagagaagggc
atctcggtgccggaccacggcttctgtcagctcatctccatcccgctgtgcacggacatc
gcctacaatcagactatcctgcccaacctgctgggtcacacgaaccaagaggatgcgggc
ctcgaggtgcatcagttctacccgctggtgaaggtgcagtgttctcccgagctgcgtttc
ttcctgtgctccatgtacgcacccgtgtgcaccgttctggataaggccatcccgccgtgc
cgctctctgtgtgagcgtgcccgccagggctgtgaagccctcatgaacaagttcggcttc
cagtggccagagcggctgcgttgcgagaacttcccggtgcacggcgcgggcgagatctgc
gtgggccagaacacgtccgacggctctgggggcgcaggcggcggccctacagcttatccc
actgcgccctacatgcccgacctgcccttcaccgcggtacccccgggggccgctgacggt
agggtccgttccgcctttcccttctcgtgcccgcgccagctcaaagtgcccccttacctg
ggctatcgcttcttgggcgagcgcgactgcggtgccccgtgcgagcccggccgcgccaac
ggtctcatgtactttaaggaagaggagaggcgcttcgcccgcctctgggtgggcgtgtgg
tccgtgctgtgctgcgcctccacgctcttcaccgttcttacctacctagtggacatgagg
cgcttcagttaccctgagcggcccatcattttcctgtccggctgctacttcatggtggcc
gtggcgcacgtggctggcttcctgctggaggaccgcgccgtgtgcgtggagcgcttctcg
gacgacggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttc
atggtactctacttcttcggcatggccagttccatctggtgggtcatcctgtcgctcact
tggtttctggcggctggcatgaagtggggccacgaggccatcgaggccaactcgcagtac
ttccacctggccgcatgggcggtgcccgccgtcaagaccatcaccatcctagccatgggc
caggtggacggggacctgcttagcggagtgtgctacgtgggcctgtccagcgtggacgcg
ctgcggggcttcgtgctggcgcccctgttcgtctacctcttcattggcacgtccttcctg
ctggccggcttcgtgtcgctcttccgcatccgcaccatcatgaagcacgacggcaccaag
accgagaagctggagaagctcatggtgcgcataggagtcttcagtgtgctctacaccgtg
cccgccaccatcgttctggcttgttatttctacgagcaggccttccgtgaacactgggag
cgcacctggctcctgcagacgtgcaagagctacgccgtgccctgccctcccggccacttc
ccgcccatgagcccagacttcacagtcttcatgatcaagtacctgatgaccatgatcgtg
ggcatcaccactggcttctggatctggtcgggaaagaccctgcagtcctggcgccgcttc
taccacagacttagccacagcagcaaaggggagactgcggtatga

DBGET integrated database retrieval system