KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500961
Entry
107500961         CDS       T06036                                 

Gene name
SHC2
Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 2
  KO
K17447  SHC-transforming protein 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04650  Natural killer cell mediated cytotoxicity
ray04722  Neurotrophin signaling pathway
ray04910  Insulin signaling pathway
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04926  Relaxin signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05034  Alcoholism
ray05100  Bacterial invasion of epithelial cells
ray05214  Glioma
ray05220  Chronic myeloid leukemia
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107500961 (SHC2)
   04014 Ras signaling pathway
    107500961 (SHC2)
   04370 VEGF signaling pathway
    107500961 (SHC2)
   04072 Phospholipase D signaling pathway
    107500961 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107500961 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107500961 (SHC2)
   04062 Chemokine signaling pathway
    107500961 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107500961 (SHC2)
   04915 Estrogen signaling pathway
    107500961 (SHC2)
   04917 Prolactin signaling pathway
    107500961 (SHC2)
   04926 Relaxin signaling pathway
    107500961 (SHC2)
   04935 Growth hormone synthesis, secretion and action
    107500961 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107500961 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107500961 (SHC2)
   05226 Gastric cancer
    107500961 (SHC2)
   05214 Glioma
    107500961 (SHC2)
   05220 Chronic myeloid leukemia
    107500961 (SHC2)
   05224 Breast cancer
    107500961 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    107500961 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107500961 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107500961 (SHC2)
   01522 Endocrine resistance
    107500961 (SHC2)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 107500961
NCBI-ProteinID: XP_015982185
LinkDB
Position
Unknown
AA seq 586 aa
MTQGPGGRAPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPAGFLGRGPAAARAAGRGAAG
GGDPQPEHPGAAGVPALAAAVLGACEPRCAAPCPLPALSRCRAAGRAGASQRARAPGPPD
AAAAADWIRKGSFIHKPAHGWLHPDARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTRTQV
TREAINRLHEAVPGVRGSWKKKAPNKALASILGKSNLRFAGMSIAVSISTDGLNLSVPAT
RQIIANHHMQSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSVISTVGQAF
ELRFKQYLHSPPKAVAPLERLTGLEESAWGDEEDADHNYYNSVPGKEPPLGGLVDSRLAL
TQPCTLGGLGQGASPVRRDARGPQWEPGSSGAASSGDGYVQADARGPRDYEDHLYVNTQG
LDAPESLPPEDSPKKDLFDMRPFEDALKLHECSVAAGTAAASFPSEDQWPSPPTRRAPIA
PTEEQLRQEPWYHGQMSRRAAEKLLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVD
PEGVVRTKDVLFESISHLIDYHLQNGQPIVAAESELHLRGVVKREP
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgacacagggtccgggcgggcgcgcgccccccgcgccccccgcacccccagagcccgag
gcgcccaccaccttctgcgcgctgctgccgcgcatgccgcagtggaagttcgcggccccg
gccggcttcctgggccgcggcccggcggcggcgcgggcagcggggcgcggggctgcgggc
ggcggcgacccccagcccgagcaccccggcgcggccggcgtccccgcgctggcggccgcc
gtcctgggcgcctgcgagccgcgctgcgccgcgccctgccccctgccggcgctcagccgc
tgccgcgccgcggggcgcgcgggggcctcgcagcgggcgcgggcgccgggtccccccgat
gccgccgcggccgccgactggatccgcaagggcagcttcatccacaagccggcgcacggc
tggctccacccggacgccagggtcctgggtcctggggtctcctacatcgtgcggtacatg
ggctgcatcgaggtcctccgctccatgcgctccctggacttcaacactcgcacccaggtc
accagagaagccatcaaccgtctccatgaggctgtgcctggcgtcaggggctcctggaag
aagaaggcacccaacaaggccctggcctccatcctgggcaagagcaacctgcggttcgcc
ggcatgagcatcgcggtcagcatctccaccgacggcctcaacctctcggtgcccgccacc
cgccagatcatcgccaaccaccacatgcagtccatctccttcgcgtctggtggagacacg
gacatgacggattatgtggcctatgtcgccaaggaccccatcaaccagagagcctgccac
atcctggagtgctgcgagggcctcgcccagagcgtcatcagcaccgtgggccaagccttc
gagctgcgcttcaaacagtacctgcacagcccccccaaggcggtcgcacccctcgaaagg
ctgacggggctggaggagtcggcctggggggacgaggaggacgcggaccacaattactac
aacagcgtcccggggaaggagccgcccctgggcgggctggtggactccaggctggccctg
actcagccctgcacccttggcggcctcggccagggagcatctcctgttcgaagagacgcc
cgcggcccgcagtgggagccgggctcctcaggtgcggcctcatcaggggacggctacgtg
caggcagacgcccgggggccccgagactacgaggaccatctgtacgtcaacacgcagggt
ctggacgccccggagtccctgccacccgaggacagccccaagaaggacctatttgacatg
cgacccttcgaggacgccctgaagctgcacgagtgctccgtggcggcgggcacggcggca
gcctcctttccctcggaggaccagtggcccagcccccccacccgccgggcccccatcgcc
cccacggaggagcagctgcggcaggagccctggtaccatggccagatgagccgtcgggca
gcggagaaactgctccgagcggacggggacttcctcgtgcgcgacagcgtcaccaacccc
gggcagtacgtcctcacgggcatgcacgcggggcagcccaagcacctgctgcttgtggac
cccgagggcgtggtgcggacgaaggacgtgctgtttgagagcatcagccacctgatcgac
taccacctgcagaacgggcagcccatcgtggccgccgagagcgagctgcacctgcgcggg
gtggtcaagcgggagccctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504308
Entry
107504308         CDS       T06036                                 

Gene name
SHC3
Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04510  Focal adhesion
ray04650  Natural killer cell mediated cytotoxicity
ray04722  Neurotrophin signaling pathway
ray04910  Insulin signaling pathway
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04926  Relaxin signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05034  Alcoholism
ray05100  Bacterial invasion of epithelial cells
ray05214  Glioma
ray05220  Chronic myeloid leukemia
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107504308 (SHC3)
   04014 Ras signaling pathway
    107504308 (SHC3)
   04072 Phospholipase D signaling pathway
    107504308 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107504308 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107504308 (SHC3)
   04062 Chemokine signaling pathway
    107504308 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107504308 (SHC3)
   04915 Estrogen signaling pathway
    107504308 (SHC3)
   04917 Prolactin signaling pathway
    107504308 (SHC3)
   04926 Relaxin signaling pathway
    107504308 (SHC3)
   04935 Growth hormone synthesis, secretion and action
    107504308 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107504308 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107504308 (SHC3)
   05226 Gastric cancer
    107504308 (SHC3)
   05214 Glioma
    107504308 (SHC3)
   05220 Chronic myeloid leukemia
    107504308 (SHC3)
   05224 Breast cancer
    107504308 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    107504308 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107504308 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107504308 (SHC3)
   01522 Endocrine resistance
    107504308 (SHC3)
SSDB
Motif
Pfam: PID SH2
Other DBs
NCBI-GeneID: 107504308
NCBI-ProteinID: XP_015988922
LinkDB
Position
Unknown
AA seq 588 aa
MLPRTKYNRFRNDSVTSVDDLLHNLSVSGGGKVSAARAAPAAAPYLVSGDALRKAPDDGP
GSLGHLLHKVSHLKLSSSGLRGLSAARERAGARLSGSCSAPSLAAPDGSAPXGPRAPAMR
AARKGRPGDEPPPRAPPASDQVLGAGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAIS
RVCEAVPGAKGAFRKRKPPSKMLSSILGKSNLQFAGMSISLTISTASLNLRTPDSKQIIA
NHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVISSIGQAFELRFK
QYLQCPSKISTFHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKTPPPGGFVDARLKARSHV
PDTAQFAGKEQTYYQGRHLGELFGEDWQQTPIRQGSVDIYSMPEGKAHVAPMGEAPTYVN
TQHLPLQAGPSASSSAESSPRKDLFDMKPFEDALKNQSMGPLLSKAASVECISPISPKAP
DARMLEELKAEPWYQGEMSRKEAEGLLKRDGDFLVRKSTTNLGSFVLTGMHDGQAKHLLL
VDPEGTIRTKDRIFDSISHLINHHLENSLPIVSAGSELCLQQPVERNP
NT seq 1767 nt   +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgtttcaggaatgactcggtgacatcggtcgatgac
cttcttcacaacctgtcggtgagcggcggcggcaaggtctcagcggcgcgcgcggccccg
gcggcggccccttacctggtgtccggagacgcgctgcgcaaggcgcccgacgatggcccg
ggtagcctgggccacctgcttcacaaggtgtcccacctgaaactctccagctcgggcctc
cgcggcctgtcggcggccagggagcgggcgggcgcgcggctctcgggcagctgcagcgcg
cccagcctggccgccccggacggcagcgcgcccnccggcccccgcgccccggccatgcgc
gccgccaggaagggccggcccggcgatgagccgccgccccgcgcgccccccgccagcgac
caggtgctgggggctggagtcacctacgttgtcaagtacttgggctgcattgaagttcta
cgctcaatgaggtctcttgactttagtacaagaacacaaattaccagggaagccatcagc
cgtgtttgcgaagctgtccctggagccaagggagcctttaggaagagaaagcctccgagc
aaaatgctgtccagcatcttgggcaagagcaacctccagtttgcggggatgagcatctcc
ctgaccatttccactgccagcctgaacttgcggacaccagactcgaaacagattatagca
aatcatcacatgcagtccatctcctttgcctctgggggagacccggacacaacagactat
gttgcgtatgtagctaaggaccctgttaatcgcagagcttgtcacattttggaatgctgt
gacgggctggcacaagatgtcatcagctccattggacaagcctttgagctccggtttaag
caatatttgcagtgtccttccaagatctccactttccatgaccgaatgcagagtctggat
gagccatggactgaagaggagggggatggctcagaccacccatactacaacagcattcca
agcaagacaccgcctccaggggggtttgttgatgctcgattgaaagccagatcccatgtc
cctgacacagcccagtttgcaggaaaagagcaaacttattaccagggaagacacttagga
gaactatttggtgaagactggcagcaaacacccatcagacaagggtctgtggacatctac
agcatgccagaagggaaagcgcatgtggcccctatgggagaagcccctacctacgtgaac
actcagcacctcccactgcaggctgggccatctgccagcagcagcgcagagagcagccca
aggaaggacctctttgacatgaaaccttttgaagatgctctcaagaaccagtccatggga
cctttgttgagcaaagcagcatctgtggagtgcatcagccccatctcacccaaagctcca
gatgccaggatgctggaagagcttaaagcagagccttggtaccaaggcgagatgagtagg
aaggaggcagaggggctgctgaagcgagatggagacttcctggtcagaaagagcaccacc
aacctgggctccttcgttctcactggcatgcacgatggccaggccaagcatctgttactc
gtggacccagaaggcacaatccggacaaaggacaggatctttgacagcatcagccacctc
atcaaccaccatctggagaacagcttacccatcgtctccgctggaagtgagctctgcctc
cagcagccggtagagaggaacccgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107505474
Entry
107505474         CDS       T06036                                 

Gene name
SHC1
Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 1
  KO
K06279  SHC-transforming protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04510  Focal adhesion
ray04650  Natural killer cell mediated cytotoxicity
ray04722  Neurotrophin signaling pathway
ray04910  Insulin signaling pathway
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04926  Relaxin signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05034  Alcoholism
ray05100  Bacterial invasion of epithelial cells
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05220  Chronic myeloid leukemia
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107505474 (SHC1)
   04014 Ras signaling pathway
    107505474 (SHC1)
   04072 Phospholipase D signaling pathway
    107505474 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107505474 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107505474 (SHC1)
   04062 Chemokine signaling pathway
    107505474 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107505474 (SHC1)
   04915 Estrogen signaling pathway
    107505474 (SHC1)
   04917 Prolactin signaling pathway
    107505474 (SHC1)
   04926 Relaxin signaling pathway
    107505474 (SHC1)
   04935 Growth hormone synthesis, secretion and action
    107505474 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107505474 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107505474 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107505474 (SHC1)
   05226 Gastric cancer
    107505474 (SHC1)
   05214 Glioma
    107505474 (SHC1)
   05220 Chronic myeloid leukemia
    107505474 (SHC1)
   05224 Breast cancer
    107505474 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    107505474 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107505474 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107505474 (SHC1)
   01522 Endocrine resistance
    107505474 (SHC1)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 107505474
NCBI-ProteinID: XP_015991142
LinkDB
Position
Unknown
AA seq 608 aa
MPLPGPLALTGRGAGPGSSLPLAPAMDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELP
SPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLKLANPAGGRLGPKAEPGRAAEDREGTT
GAAXPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKV
MGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRP
LSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVA
YVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGS
AWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGATRPTPSSAQPPTQLGATLP
VGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQHLDKARHAGAGAGPPGLAVNGGAP
RDLFDMKPFEDALRAPPPPNSVAMAEQLRGEPWFHGKLSRREAEALLQLDGDFLVRESTT
TPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFDSVSHLISHHMDNHLPIISAGSELCL
QQPVTRRP
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgcccctgcctggcccccttgccctgaccggcaggggggccgggccgggcagcagcctc
cctctcgctccagccatggatctcctgccccccaagcccaagtacaacccacttcggaat
gagtctctgtcatcgctggaggagggggcttctgggtccaccccgccggaggagctgcct
tccccatcagcctcgtccctggggcccatcctgccacctctgcctggggacgatagtccc
accaccctgtgctccttcttcccccggatgagcaacctgaagctggccaacccggctggg
gggcgcctggggccgaaggcggagccaggcagggcggctgaggaccgggaggggaccaca
ggggccgcgntgccagactcaggccccctgcccctcctccaggacatgaacaagctgagt
ggaggcggcgggcgcaggactcgggtggaagggggccagctggggggcgaggagtggacc
cgccacgggagctttgtcaataagcccacgcggggctggctgcatcccaacgacaaagtc
atgggacctggggtttcctacttggtccggtacatgggctgcgtggaggtcctgcagtca
atgcgggctctggacttcaacacccggacccaggtcaccagggaggccatcagtctggtg
tgcgaggctgtgccaggtgctaagggagcaacaaggaggaggaagccctgtagccgcccg
ctcagctccattctggggaggagtaacctgaagttcgccggaatgcccatcactctcacc
gtttccaccagcagcctcaacctcatggccgcagactgcaaacagatcatcgccaaccac
cacatgcagtctatctcgtttgcgtccggcggggacccggacacagccgagtatgtcgcc
tacgttgccaaagacccagtgaatcagagagcctgccacatcctggagtgtcctgaaggg
cttgctcaggatgtcatcagcaccattggccaggccttcgagctgcgcttcaaacaatac
ctcaggaacccgcccaagctggtcaccccccacgacaggatggccggctttgatggctcg
gcttgggatgaggaggaggaagagccacctgaccatcagtactataatgacttcccgggg
aaggaaccccctcttggaggcgtggtggacatgaggcttcgggagggagccgccccgggg
gctacccgccctaccccgtccagtgcccagccacccacccagctgggagctacgctgcct
gtgggccagcctgttggaggagacccggaagtccgcaagcagatgccacctccaccaccc
tgcccaggccgagagctctttgacgacccctcctatgtcaacgtccagcacctggacaaa
gcccggcacgcgggggctggggccgggccccccggcctggcggtcaatggtggcgccccg
cgagacctttttgacatgaagccttttgaagatgccctccgggcacctcccccgcctaac
tcggtggccatggccgagcagctccggggggagccctggttccatgggaagctgagccgg
cgggaggccgaggcgctgctgcagctggacggggacttcctggtgcgggagagcacgacc
acgcccggccagtatgtgctcaccggcctgcagagcgggcagcccaagcacctgctgctg
gtggaccccgagggcgtggttcggaccaaggatcaccgcttcgatagtgtcagccacctc
atcagccaccacatggacaatcacttgcccatcatctctgcgggcagcgaactgtgtcta
cagcagcctgtgacccggaggccatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512423
Entry
107512423         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 1-like
  KO
K06279  SHC-transforming protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04510  Focal adhesion
ray04650  Natural killer cell mediated cytotoxicity
ray04722  Neurotrophin signaling pathway
ray04910  Insulin signaling pathway
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04926  Relaxin signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05034  Alcoholism
ray05100  Bacterial invasion of epithelial cells
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05220  Chronic myeloid leukemia
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107512423
   04014 Ras signaling pathway
    107512423
   04072 Phospholipase D signaling pathway
    107512423
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107512423
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107512423
   04062 Chemokine signaling pathway
    107512423
  09152 Endocrine system
   04910 Insulin signaling pathway
    107512423
   04915 Estrogen signaling pathway
    107512423
   04917 Prolactin signaling pathway
    107512423
   04926 Relaxin signaling pathway
    107512423
   04935 Growth hormone synthesis, secretion and action
    107512423
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107512423
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107512423
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107512423
   05226 Gastric cancer
    107512423
   05214 Glioma
    107512423
   05220 Chronic myeloid leukemia
    107512423
   05224 Breast cancer
    107512423
  09165 Substance dependence
   05034 Alcoholism
    107512423
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107512423
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107512423
   01522 Endocrine resistance
    107512423
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 107512423
NCBI-ProteinID: XP_016003428
LinkDB
Position
Unknown
AA seq 611 aa
MPLPGPLALTGRGAGPGSSLPLAPAMDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELP
SPSASSLGPILPPLPGDDSPTTLCSFFPRMSNLKLANPAGGRLGPKAEPGRAAEDREGTT
GAGVPDSGPLPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKV
MGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRP
LSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVA
YVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGS
AWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAAPGATRPTPSSAQPPTQLGATLP
VGQPVGGDPEVRKQMPPPPPCPGRELFDDPSYVNVQHLDKARHAGAGAGPPGLAVNGGAP
RDLFDMKPFEDAXRAPPPPNSVAMAEQLRGEPWFHGKLSRREAEALLQLDGDFLVRESTT
TPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFDSVSHLISFTTDGHITCPSSLRADEL
CLQAASVTRRP
NT seq 1836 nt   +upstreamnt  +downstreamnt
atgcccctgcctggcccccttgccctgaccggcaggggggccgggccgggcagcagcctc
cctctcgctccagccatggatctcctgccccccaagcccaagtacaacccacttcggaat
gagtctctgtcatcgctggaggagggggcttctgggtccaccccgccggaggagctgcct
tccccatcagcctcgtccctggggcccatcctgccacctctgcctggggacgatagtccc
accaccctgtgctccttcttcccccggatgagcaacctgaagctggccaacccggctggg
gggcgcctggggccgaaggcggagccaggcagggcggctgaggaccgggaggggaccaca
ggggccggcgtgccagactcaggccccctgcccctcctccaggacatgaacaagctgagt
ggaggcggcgggcgcaggactcgggtggaagggggccagctggggggcgaggagtggacc
cgccacgggagctttgtcaataagcccacgcggggctggctgcatcccaacgacaaagtc
atgggacctggggtttcctacttggtccggtacatgggctgcgtggaggtcctgcagtca
atgcgggctctggacttcaacacccggacccaggtcaccagggaggccatcagtctggtg
tgcgaggctgtgccaggtgctaagggagcaacaaggaggaggaagccctgtagccgcccg
ctcagctccattctggggaggagtaacctgaagttcgccggaatgcccatcactctcacc
gtttccaccagcagcctcaacctcatggccgcagactgcaaacagatcatcgccaaccac
cacatgcagtctatctcgtttgcgtccggcggggacccggacacagccgagtatgtcgcc
tacgttgccaaagacccagtgaatcagagagcctgccacatcctggagtgtcccgaaggg
ctcgctcaggatgtcatcagcaccattggccaggccttcgagctgcgcttcaaacaatac
ctcaggaacccgcccaagctggtcaccccccacgacaggatggccggctttgatggctcg
gcttgggatgaggaggaggaagagccacctgaccatcagtactataatgacttcccgggg
aaggaaccccctcttggaggcgtggtggacatgaggcttcgggagggagccgccccgggg
gctacccgccctaccccgtccagtgcccagccacccacccagctgggagctacgctgcct
gtgggccagcctgttggaggagacccggaagtccgcaagcagatgccacctccaccaccc
tgcccaggccgagagctctttgacgacccctcctatgtcaacgtccagcacctggacaaa
gcccggcacgcgggggctggggccgggccccccggcctggcggtcaatggtggcgccccg
cgagacctttttgacatgaagccttttgaagatgccncccgggcacctcccccgcctaac
tcggtggccatggccgagcagctccggggggagccctggttccatgggaagctgagccgg
cgggaggccgaggcgctgctgcagctggacggggacttcctggtgcgggagagcacgacc
acgcccggccagtatgtgctcaccggcctgcagagcgggcagcccaagcacctgctgctg
gtggaccccgagggcgtggttcggaccaaggatcaccgcttcgatagtgtcagccacctc
atcagcttcaccactgatggacacatcacttgcccatcatctctgcgggcagacgaactg
tgtctacaggcagcatctgtgacccggaggccatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519965
Entry
107519965         CDS       T06036                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04062  Chemokine signaling pathway
ray04072  Phospholipase D signaling pathway
ray04510  Focal adhesion
ray04650  Natural killer cell mediated cytotoxicity
ray04722  Neurotrophin signaling pathway
ray04910  Insulin signaling pathway
ray04915  Estrogen signaling pathway
ray04917  Prolactin signaling pathway
ray04926  Relaxin signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05034  Alcoholism
ray05100  Bacterial invasion of epithelial cells
ray05206  MicroRNAs in cancer
ray05214  Glioma
ray05220  Chronic myeloid leukemia
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107519965 (SHC4)
   04014 Ras signaling pathway
    107519965 (SHC4)
   04072 Phospholipase D signaling pathway
    107519965 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107519965 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107519965 (SHC4)
   04062 Chemokine signaling pathway
    107519965 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107519965 (SHC4)
   04915 Estrogen signaling pathway
    107519965 (SHC4)
   04917 Prolactin signaling pathway
    107519965 (SHC4)
   04926 Relaxin signaling pathway
    107519965 (SHC4)
   04935 Growth hormone synthesis, secretion and action
    107519965 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107519965 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107519965 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107519965 (SHC4)
   05226 Gastric cancer
    107519965 (SHC4)
   05214 Glioma
    107519965 (SHC4)
   05220 Chronic myeloid leukemia
    107519965 (SHC4)
   05224 Breast cancer
    107519965 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    107519965 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    107519965 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107519965 (SHC4)
   01522 Endocrine resistance
    107519965 (SHC4)
SSDB
Motif
Pfam: PID SH2 Delta_lysin
Other DBs
NCBI-GeneID: 107519965
NCBI-ProteinID: XP_016018734
LinkDB
Position
Unknown
AA seq 629 aa
MRERSQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDEGSPGGSVGNKSSPQPPY
PALAPHLPAEDATLASQESPTPLCTLIPRMASVKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSNPASPEPSQNRARSAPPSQQDVVGHRPTALTPDACPLPGPGEPTPGNRQDRN
FLQHLLGMGMNYYVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVPGANGAIKRRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTYSLTLMNLDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRNGMAQDVITTIGQAFELRFKQYLKNSSLNTSCESEEV
HIDGHAEERDHEYYNEIPGKQPPAGGVSDVRIKVQATEQMAYCPIRCEKLCYLPGNSKCS
SVYENCLEQSRAMGNAHERGVQYQRDTSLMKHTCRVDLFDDPCYINTQALQSTLGSARNQ
SSARSLGSPWHREKVPETVQPGAMAQPAGSHSLPHIKQQLRNEECYHGKLSRKAAESLLV
KDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDNS
LPIISSGSEVSLKQPVRKDNNPGLLHSNK
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgcgagaacgcagtcaggacagcttggcaggactcgtgctgtatgtaggactcttcggg
caccccgggatgctgcacagggccaagtacagccgctttcggaacgagtccatcacgtcc
ttggacgaaggcagccctggaggctccgtcgggaacaagagctcgccgcagcctccctac
cccgccctggctcctcacttgccggctgaagatgccaccttggcgtcccaggagagccct
accccactgtgcaccttgatcccgcgcatggccagcgtgaaactagccaacccagccacc
ttgctgagtctgaaaaacttttgcttgggtaccaaagaggtgcctcggctgaagctccag
gaaagccaggatccggctcccagcaacccggcttccccagaacccagtcaaaatagggcc
aggtctgcgcctccgtcgcagcaggacgtggttgggcacaggccgaccgccttaactccc
gatgcctgcccccttcccggccctggggagccaaccccagggaacaggcaggacaggaac
tttctgcagcacctgttggggatgggcatgaactattatgtgaggtacatgggctgtatt
gaagtgctacaatcaatgaggtcactggattttggcatgagaacccaagttacaagggaa
gcaatcagtcgcctgtgtgaagctgtccctggggcaaatggagccattaaaaggcgtaag
cctccagttaagttcctatcaacagttctgggcaaaagtaaccttcagttttcgggaatg
aatataaaactgaccatctcaacatacagccttacactgatgaatcttgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggggatcctgatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgccacatattg
gaatgccgcaatggaatggcccaagacgtcataactaccatagggcaggcttttgagctc
cggtttaaacagtatttgaaaaattcttctttgaatacttcttgtgaaagtgaggaggtg
catattgatggccatgctgaggagagagatcatgagtattacaatgaaataccagggaag
cagccacctgcaggtggtgtttcggatgtgcgaatcaaagttcaagccacagaacaaatg
gcttactgtcccatacgatgtgaaaagttgtgttatttgcctggaaactccaagtgcagc
agtgtatacgagaactgtttggaacaaagcagggcaatgggtaatgcccatgagagaggg
gtacagtaccaaagagacacctcgttaatgaagcacacatgtcgagtggatctcttcgat
gacccctgctacattaatacccaggctcttcaaagtacacttggctctgcccgaaatcag
agctcagctcgctcgctggggagcccatggcaccgtgaaaaagtaccagaaactgttcag
ccgggtgccatggcccagcctgccggctcacattctttgccacacattaagcagcaactg
cggaatgaagaatgctaccatggcaagcttagcaggaaggcagcagagagcctcctagtt
aaggatggggactttttggttcgagaaagtgcaacatctcctggccaatatgtactgagc
ggactacagggaggccaggcaaaacatcttctcctcgtggatcctgaaggcaaggtgagg
accaaggatcatgtatttgataatgttggacaccttatcagataccatatggataatagt
ttaccaatcatctcttctggaagtgaagtaagccttaaacaaccagtaagaaaagataac
aatccaggacttttgcattcaaataaatga

DBGET integrated database retrieval system