KEGG   Rousettus aegyptiacus (Egyptian rousette): 107500976
Entry
107500976         CDS       T06036                                 

Gene name
PRKAB2
Definition
(RefSeq) LOW QUALITY PROTEIN: 5'-AMP-activated protein kinase subunit beta-2
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04068  FoxO signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04371  Apelin signaling pathway
ray04530  Tight junction
ray04710  Circadian rhythm
ray04714  Thermogenesis
ray04910  Insulin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107500976 (PRKAB2)
   04068 FoxO signaling pathway
    107500976 (PRKAB2)
   04152 AMPK signaling pathway
    107500976 (PRKAB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107500976 (PRKAB2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107500976 (PRKAB2)
   04922 Glucagon signaling pathway
    107500976 (PRKAB2)
   04920 Adipocytokine signaling pathway
    107500976 (PRKAB2)
   04921 Oxytocin signaling pathway
    107500976 (PRKAB2)
  09149 Aging
   04211 Longevity regulating pathway
    107500976 (PRKAB2)
   04213 Longevity regulating pathway - multiple species
    107500976 (PRKAB2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    107500976 (PRKAB2)
   04714 Thermogenesis
    107500976 (PRKAB2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107500976 (PRKAB2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107500976 (PRKAB2)
   04931 Insulin resistance
    107500976 (PRKAB2)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48
Other DBs
NCBI-GeneID: 107500976
NCBI-ProteinID: XP_015982208
LinkDB
Position
Unknown
AA seq 272 aa
MGNTASERXAAERHGAKAARAEGGAARAXGPERRIMVGSTDDPGVFSLPDAKLPGDKEFV
SWQQDLEDSARPAQQARPTVIRWSEGGEAVFISGSFNNWSAKIPLIKSHNDFVAILDLPE
GEHQYKFFVDGQWVHDPSEPVVTSQLGTINNLIHVKKSDFEVFDALKLDSMESSETSCRD
LSSSPPGPYGQEMYVFRSEERFKSPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNH
LYALSIKDSVMVLSATHRYKKKYVTTLLYKPI
NT seq 819 nt   +upstreamnt  +downstreamnt
atggggaacaccgcgagcgagcggnnggccgcggagcgccacggcgccaaggcggcgcgc
gccgagggcggcgcggcccgggcgncgggcccggagcgcaggatcatggtgggcagcacg
gacgaccccggcgtcttcagcctgcccgacgccaagctccccggggacaaagagtttgta
tcatggcagcaggacctggaggattccgcgaggcccgctcagcaggcgcggcccaccgtg
atccgctggtccgaaggcggcgaggcggtcttcatctccggctccttcaacaactggagc
gccaagatcccactgattaagagccataacgactttgtggccatcctggacctccctgag
ggagagcaccagtacaagttcttcgtggatggacagtgggttcacgatccatcggagcct
gtggttaccagtcagctcgggacgattaacaatttgatccatgtcaagaaatcggatttt
gaggtgttcgatgctttaaagctagattccatggaaagctcggagacttcctgtcgcgac
ctttccagctcacccccagggccttacggtcaagaaatgtatgtgtttcgatccgaggag
agattcaagtctccgcccatcctgcctcctcaccttcttcaggttattcttaacaaggac
actaatatttcttgtgaccccgccttgctccccgaacccaatcacgttatgctgaaccat
ctctacgccttgtccattaaggacagcgtgatggtccttagcgcaacccatcgctacaag
aagaagtatgtcaccactctgctgtacaagcccatctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512438
Entry
107512438         CDS       T06036                                 

Gene name
PRKAA1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04068  FoxO signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04371  Apelin signaling pathway
ray04530  Tight junction
ray04710  Circadian rhythm
ray04714  Thermogenesis
ray04910  Insulin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray05410  Hypertrophic cardiomyopathy
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107512438 (PRKAA1)
   04068 FoxO signaling pathway
    107512438 (PRKAA1)
   04151 PI3K-Akt signaling pathway
    107512438 (PRKAA1)
   04152 AMPK signaling pathway
    107512438 (PRKAA1)
   04150 mTOR signaling pathway
    107512438 (PRKAA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107512438 (PRKAA1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107512438 (PRKAA1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107512438 (PRKAA1)
   04922 Glucagon signaling pathway
    107512438 (PRKAA1)
   04920 Adipocytokine signaling pathway
    107512438 (PRKAA1)
   04921 Oxytocin signaling pathway
    107512438 (PRKAA1)
  09149 Aging
   04211 Longevity regulating pathway
    107512438 (PRKAA1)
   04213 Longevity regulating pathway - multiple species
    107512438 (PRKAA1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    107512438 (PRKAA1)
   04714 Thermogenesis
    107512438 (PRKAA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107512438 (PRKAA1)
   05410 Hypertrophic cardiomyopathy
    107512438 (PRKAA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107512438 (PRKAA1)
   04931 Insulin resistance
    107512438 (PRKAA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107512438 (PRKAA1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107512438 (PRKAA1)
   03029 Mitochondrial biogenesis [BR:ray03029]
    107512438 (PRKAA1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107512438 (PRKAA1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   107512438 (PRKAA1)
Membrane trafficking [BR:ray04131]
 Autophagy
  Other autophagy associated proteins
   Others
    107512438 (PRKAA1)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107512438 (PRKAA1)
  Mitophagy factors
   Other mitophagy factors
    107512438 (PRKAA1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 107512438
NCBI-ProteinID: XP_016003448
LinkDB
Position
Unknown
AA seq 559 aa
MRRLSSWRKMATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNR
QKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNG
RLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEF
LRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDG
IFYTPQYLNPSVISLLKHMLQVDPMKRATIKDIREHEWFKQDLPKYLFPEDPSYSSTMID
DEALKEVCEKFECSEEEVLSCLYNRNHQDPLAVAYHLIIDNRRIMNEAKDFYLATSPPDS
FLDDHHLSRPHPERVPFLVAETPRARHTLDELNPQKSKHQGVRKAKWHLGIRSQSRPNDI
MAEVCRAIKQLDYEWKVVNPYYLRVRRKNPVTSTYSKMSLQLYQVDSRTYLLDFRSIDDE
ITEAKSGTATPQRSGSVSNYRSCQRNDSDAEAQGKSSEASLTSSVTSLDSSPVDLTPRPG
SHTIEFFEMCANLIKILAQ
NT seq 1680 nt   +upstreamnt  +downstreamnt
atgcgcagactcagttcctggagaaagatggcgacagctgagaagcagaaacacgacggg
cgggtgaagatcggccactacatcctgggggacacgctgggggtcggcaccttcggcaaa
gtgaaggttggcaaacatgaactgactggacataaagttgccgtgaagatactcaatcga
cagaagattcgaagccttgatgtcgtaggaaaaatccgcagagaaattcagaacctcaag
cttttcaggcatcctcatataattaaactgtaccaggtcatcagtacaccatctgatatt
ttcatggtgatggaatatgtctcaggaggagagctatttgattatatctgtaaaaatgga
aggctggacgaaaaagaaagtcgacgcctgttccaacaaatcctttctggtgtggattac
tgccacaggcatatggtggtccacagagatttgaaacctgaaaatgtcctgcttgatgca
cacatgaatgcaaagatagctgattttggtctttcaaacatgatgtcagatggtgaattt
ttaagaacaagttgtggctcacccaactatgctgcgccagaagtaatttcaggaagattg
tacgcaggtccagaggtggatatatggagtagtggggttattctctatgctttattatgt
ggaacccttccattcgatgatgatcatgtgccaactctttttaagaagatatgtgatgga
atcttttatacccctcagtatttaaacccttctgtgattagccttttgaaacatatgctg
caggtggatcctatgaagagagccacgattaaagatatcagggaacatgaatggttcaaa
caggatcttccaaaatatctctttcctgaggatccatcatatagttcaaccatgattgat
gatgaagccttaaaagaagtatgtgaaaaatttgagtgctcagaagaggaggttctcagc
tgcctttataacagaaatcaccaggaccctttagcagttgcttaccacctcataatagat
aacaggagaataatgaatgaggccaaagatttttacttggcgacaagcccacctgattct
tttctcgatgatcaccatttgtctcggccccatcccgaaagagtaccattcttggttgct
gaaacaccaagggcgcgccataccctcgatgaattaaatccacagaaatccaaacaccaa
ggtgtaaggaaagcaaaatggcatttgggaatcagaagtcaaagtcgaccaaatgatatc
atggcagaagtttgtagagcaattaaacaactggattatgaatggaaggtcgtaaaccca
tattatttgcgtgttcgaaggaagaaccctgtgacaagtacatactccaaaatgagtcta
cagttataccaagtggatagtaggacatacttattggatttccgtagtattgatgatgaa
attaccgaagccaaatcagggactgctacaccacagagatcgggatcggttagtaattat
cgatcttgccaaaggaatgattcagatgctgaggctcaaggaaaatcctcagaagcttct
cttacctcatctgtgacctcacttgactcttctcctgttgacttaactccaagacctgga
agtcacacaatagaattttttgagatgtgtgcaaatttaattaaaattcttgcacagtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107513175
Entry
107513175         CDS       T06036                                 

Gene name
PRKAB1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04068  FoxO signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04371  Apelin signaling pathway
ray04530  Tight junction
ray04710  Circadian rhythm
ray04714  Thermogenesis
ray04910  Insulin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107513175 (PRKAB1)
   04068 FoxO signaling pathway
    107513175 (PRKAB1)
   04152 AMPK signaling pathway
    107513175 (PRKAB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107513175 (PRKAB1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107513175 (PRKAB1)
   04922 Glucagon signaling pathway
    107513175 (PRKAB1)
   04920 Adipocytokine signaling pathway
    107513175 (PRKAB1)
   04921 Oxytocin signaling pathway
    107513175 (PRKAB1)
  09149 Aging
   04211 Longevity regulating pathway
    107513175 (PRKAB1)
   04213 Longevity regulating pathway - multiple species
    107513175 (PRKAB1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    107513175 (PRKAB1)
   04714 Thermogenesis
    107513175 (PRKAB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107513175 (PRKAB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107513175 (PRKAB1)
   04931 Insulin resistance
    107513175 (PRKAB1)
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 DUF4758
Other DBs
NCBI-GeneID: 107513175
NCBI-ProteinID: XP_016005036
LinkDB
Position
Unknown
AA seq 270 aa
MGNTSSERAALERQGGHKTPRRDSSGGAKDGDRPKILMDSPEDADLFHSEDIKAPEKEEF
LAWQHDLEVNDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPE
GEHQYKFFVDGQWTHDPSEPVVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELS
SSPPGPYHQEPYVSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLY
ALSIKDGVMVLSATHRYKKKYVTTLLYKPI
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcaacacgagcagcgagcgcgccgcgctggagaggcagggcggccataagacgccc
cgaagggacagctcggggggcgctaaggatggggacaggcccaagatcctgatggacagc
cccgaagacgccgaccttttccactccgaggacatcaaggctccagagaaggaggaattc
ctggcctggcagcacgatctggaagtgaacgataaagctcccgcccaggctcggccaact
gtatttcgatggacggggggcggaaaggaagtgtacttatctgggtccttcaacaactgg
agtaaacttcccctcacgaggagccacaataacttcgtagccatcttggacctgccagaa
ggagagcatcagtacaagttcttcgtggatggtcagtggacacacgacccttccgagcct
gtagtaaccagccagcttggcacagttaacaacatcattcaagtgaagaaaaccgacttt
gaagtatttgatgcgttaatggtggattcccagaagtgctccgatgtgtctgaactgtcc
agttccccaccaggaccctaccatcaggagccctacgtctccaaaccagaagagcggttt
aaagcgccacccattctccccccacatctgctccaggtcatcctgaacaaggacacgggg
atttcttgtgatccggcattgctccccgaacccaaccacgtcatgctgaaccacctgtat
gcgctttctatcaaggatggagtgatggtactcagcgcaacccaccggtacaagaaaaag
tatgtcaccaccttgttatacaagcccatatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514235
Entry
107514235         CDS       T06036                                 

Gene name
PRKAG1
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04068  FoxO signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04371  Apelin signaling pathway
ray04530  Tight junction
ray04710  Circadian rhythm
ray04714  Thermogenesis
ray04910  Insulin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107514235 (PRKAG1)
   04068 FoxO signaling pathway
    107514235 (PRKAG1)
   04152 AMPK signaling pathway
    107514235 (PRKAG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107514235 (PRKAG1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107514235 (PRKAG1)
   04922 Glucagon signaling pathway
    107514235 (PRKAG1)
   04920 Adipocytokine signaling pathway
    107514235 (PRKAG1)
   04921 Oxytocin signaling pathway
    107514235 (PRKAG1)
  09149 Aging
   04211 Longevity regulating pathway
    107514235 (PRKAG1)
   04213 Longevity regulating pathway - multiple species
    107514235 (PRKAG1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    107514235 (PRKAG1)
   04714 Thermogenesis
    107514235 (PRKAG1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107514235 (PRKAG1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107514235 (PRKAG1)
   04931 Insulin resistance
    107514235 (PRKAG1)
SSDB
Motif
Pfam: CBS DRTGG Cbl_N3 DUF2497
Other DBs
NCBI-GeneID: 107514235
NCBI-ProteinID: XP_016007241
LinkDB
Position
Unknown
AA seq 330 aa
METVTSSDSFPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKA
FFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREV
YLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFI
TEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDI
YSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRL
VVVDENDVVKGIVSLSDILQALVLTGGEKP
NT seq 993 nt   +upstreamnt  +downstreamnt
atggagacggtaacttcttcagatagcttcccagctgtggaaaatgaacatcctcaagag
accccagaatccaacaatagtgtgtatacttccttcatgaagtctcatcgctgctatgac
ctgattcccacaagttccaaattggttgtatttgatacatccctgcaggtgaaaaaagct
ttctttgctctggtgactaatggtgtacgagctgcccctttgtgggatagtaagaagcaa
agctttgtgggcatgctgaccatcaccgatttcatcaatatcctgcaccgctactataaa
tcagccttggtacagatctatgagctggaagaacacaagatagaaacttggagagaggtg
tacctacaggactcctttaaaccacttgtctgcatttctcctaatgccagcttgtttgat
gctgtctcttcattaattcgaaacaagatccataggctgccagttattgacccagaatca
ggcaacactttgtacatcctcacccacaagcgcatcctcaagttcctcaaattgtttatc
actgagttccccaagccagagttcatgtccaagtctctggaagagctacagattggcacc
tacgccaacatcgctatggtccgcactaccacccctgtgtacgtggctttgggcatcttt
gtacaacaccgagtctcagccctgcctgtggtggatgagaaagggcgtgtggtggacatc
tactccaaatttgatgttatcaatctagcagcagaaaagacctacaacaacctagatgtg
tctgtgaccaaagccttgcaacatcgatcacattactttgaaggtgtcctcaagtgctac
ctgcatgagactctggagaccatcattaacaggctggtggaagcagaggttcaccgactt
gtagtagtggatgaaaatgatgtggtcaagggaattgtatcactgtcggacatcctgcag
gccctggtgctcacaggcggagagaagccctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516736
Entry
107516736         CDS       T06036                                 

Gene name
PRKAG3
Definition
(RefSeq) LOW QUALITY PROTEIN: 5'-AMP-activated protein kinase subunit gamma-3
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04068  FoxO signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04371  Apelin signaling pathway
ray04530  Tight junction
ray04710  Circadian rhythm
ray04714  Thermogenesis
ray04910  Insulin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107516736 (PRKAG3)
   04068 FoxO signaling pathway
    107516736 (PRKAG3)
   04152 AMPK signaling pathway
    107516736 (PRKAG3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107516736 (PRKAG3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107516736 (PRKAG3)
   04922 Glucagon signaling pathway
    107516736 (PRKAG3)
   04920 Adipocytokine signaling pathway
    107516736 (PRKAG3)
   04921 Oxytocin signaling pathway
    107516736 (PRKAG3)
  09149 Aging
   04211 Longevity regulating pathway
    107516736 (PRKAG3)
   04213 Longevity regulating pathway - multiple species
    107516736 (PRKAG3)
  09159 Environmental adaptation
   04710 Circadian rhythm
    107516736 (PRKAG3)
   04714 Thermogenesis
    107516736 (PRKAG3)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107516736 (PRKAG3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107516736 (PRKAG3)
   04931 Insulin resistance
    107516736 (PRKAG3)
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 107516736
NCBI-ProteinID: XP_016012250
LinkDB
Position
Unknown
AA seq 494 aa
MEPELERALRRTPRWSSLVGPEHQEMSFLEQGDSTSWPSLAMTTSSERSHGKRGAKASRW
TRQEAVEEEEVPDLGEGQGLQSRPDAESIGLEATFPKAIPLARSATLAGVDTPLTKWDIL
SPECTDSAAGCSMDSLELDEEFPATATYRYELGLVEERPALCPSPQAPLPKQGWDDELQK
PGAQVYMHFMQKHTCYDAMATSSKLVIFDTTLEIKKAFFALVANGVRAAPLWDSKKQSFV
GMLTITDFILVLQRYYRSPLVQIYEIEEHKIETWREIYLQGCFKPLVSISPNDSLFEAVY
TLIKNRIHRLPVLDPVSGNVLYIITHKRLLKFLHIFGALLPRPSFISRTIQDLGIGTFRD
LAVVLETAPVLTALDIFVDRRVSALPVVNETGQVVGLYSRFDVIHLAAQQTYNHLDMSVA
EALRQRTLCMEGVLSCQPEESLEEVINRIVREQVHRLVLVDKTQHLLGVVSLSDILQALV
LSPAGLDPSMPENI
NT seq 1485 nt   +upstreamnt  +downstreamnt
atggagcccgagctggagcgtgcactgcgcaggaccccaaggtggagcagtcttgtggga
cctgaacatcaagagatgagcttcctagagcaaggagatagcacttcatggccatcactg
gccatgaccaccagctcagaaagaagccacgggaaacggggggccaaggcctcaagatgg
acaaggcaggaggctgtggaagaagaggaggtgccagacctgggagaaggccaaggtctt
caatccaggccagatgctgagtccatcgggctggaggccacattccccaaggccatacct
ttggctcggtctgctactttggctggggtggacaccccactaacaaagtgggacatcctc
tcccctgagtgtacagactcagctgctggctgcagcatggacagtctggagctggacgaa
gagttcccagctacagcaacctataggtatgagctcggcctggtggaagagaggcctgcg
ctgtgcccgtctccgcaggccccgttacccaagcagggctgggatgacgagctgcagaag
ccaggggcccaggtctacatgcacttcatgcagaagcacacctgctacgatgccatggcg
accagctccaagctggtcatcttcgacaccacgctggagatcaaaaaggccttctttgcc
ttggtggccaatggtgtccgggcggcacctctgtgggacagcaagaagcagagctttgtg
gggatgctgaccatcacagacttcatcctggtgctgcagcgctattacaggtctcccctg
gtccagatctatgagattgaagaacataagatcgagacctggagggagatctaccttcaa
ggctgcttcaagcctctggtctccatctctcctaatgacagcctgtttgaagctgtctac
acccttatcaagaacaggatccaccgcctgcctgtcctagacccagtctcaggcaacgtg
ctctacatcatcacacacaaacggctactcaagttcctgcacatctttggtgccctgctg
ccccggccatccttcatctcccgaaccatccaagacttgggcattggcacattccgagac
ttggctgtggtgctggaaacggcacccgtcctgaccgcgctggacatctttgtggaccgg
cgcgtgtctgctttgcccgtggtcaacgaaactggtcaggtcgtaggcctctactcccgc
ttcgatgtgatccacttggctgcccaacaaacctacaaccacctagacatgagcgtggca
gaagcactgaggcagaggacactgtgtatggagggggtcctttcttgccagcctgaagag
agcctggaggaagtcatcaaccggatcgtccgggagcaggtacaccgtttggtgctagtg
gataagacccagcatctcctgggcgtggtgtccctctccgacatccttcaggcactggtg
ctcagccctgctggcctggatccctcaatgcctgagaatatctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518350
Entry
107518350         CDS       T06036                                 

Gene name
PRKAA2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04068  FoxO signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04371  Apelin signaling pathway
ray04530  Tight junction
ray04710  Circadian rhythm
ray04714  Thermogenesis
ray04910  Insulin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray05410  Hypertrophic cardiomyopathy
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107518350 (PRKAA2)
   04068 FoxO signaling pathway
    107518350 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    107518350 (PRKAA2)
   04152 AMPK signaling pathway
    107518350 (PRKAA2)
   04150 mTOR signaling pathway
    107518350 (PRKAA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107518350 (PRKAA2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107518350 (PRKAA2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107518350 (PRKAA2)
   04922 Glucagon signaling pathway
    107518350 (PRKAA2)
   04920 Adipocytokine signaling pathway
    107518350 (PRKAA2)
   04921 Oxytocin signaling pathway
    107518350 (PRKAA2)
  09149 Aging
   04211 Longevity regulating pathway
    107518350 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    107518350 (PRKAA2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    107518350 (PRKAA2)
   04714 Thermogenesis
    107518350 (PRKAA2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107518350 (PRKAA2)
   05410 Hypertrophic cardiomyopathy
    107518350 (PRKAA2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107518350 (PRKAA2)
   04931 Insulin resistance
    107518350 (PRKAA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107518350 (PRKAA2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107518350 (PRKAA2)
   03029 Mitochondrial biogenesis [BR:ray03029]
    107518350 (PRKAA2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     107518350 (PRKAA2)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   107518350 (PRKAA2)
Membrane trafficking [BR:ray04131]
 Autophagy
  Other autophagy associated proteins
   Others
    107518350 (PRKAA2)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    107518350 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    107518350 (PRKAA2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH
Other DBs
NCBI-GeneID: 107518350
NCBI-ProteinID: XP_016015405
LinkDB
Position
Unknown
AA seq 554 aa
MAEKQKHDGRVKIGHYVLGVTLGVGTFGKSRVESHKLSGYLASVRKIKWERQKIRSLDVV
GKIKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEMEARR
LFQQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPN
YAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLN
RSVATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCE
KFECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDSAMH
IPPGLKPHPERMPPLIADSPKARCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPYDIMAE
VYRAMKQLDFEWKVVNAYHLRVRRKNPVTGNYVKMSLQLYLVDNRSYLLDFKSIDDEVVE
QRSGSSTPQRSCSAAGLHRPRSSFDSVTPESHSLSGSLTGSLTGNTLSSVTPRLGSHTMD
FFEMCASLITTLAR
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggctgagaagcagaagcacgacgggcgagtgaagatcggacactacgtgctgggggtc
acgctgggcgtcggcaccttcggcaagtcaagagttgaatctcataaattgagtgggtat
ttagcatcagttcgaaaaataaagtgggaaagacagaagattcgcagtttagatgttgtt
ggaaaaataaaacgggaaattcaaaatctaaaactctttcgtcaccctcatattatcaaa
ctataccaggtgatcagtactccaacagatttttttatggtaatggaatatgtgtctggt
ggtgaattatttgactacatctgtaaacatggacgggttgaagagatggaagccaggagg
ctctttcagcagatcctgtctgctgtggattactgtcacaggcatatggttgttcatcga
gacctgaaacctgaaaatgtcctgttggatgcacacatgaatgccaagattgctgatttt
ggattatctaatatgatgtcagatggtgaatttctacgaactagttgtggatctccaaat
tatgctgcacctgaagtaatctcaggcagattgtatgcaggtcctgaagtcgatatctgg
agctgcggtgttattttatatgctcttctttgtggcaccctcccatttgatgatgagcat
gtacctacattatttaagaagatccgagggggtgttttttacatcccagagtatctgaat
cgttctgttgccactctcctgatgcatatgctgcaggtcgaccccctgaaacgagcaact
atcaaagacataagagagcatgaatggtttaaacaagatttgcccagttacttatttcct
gaagacccctcctatgatgctaacgtcattgatgatgaggctgtgaaagaagtgtgtgaa
aaatttgagtgtacagaatcagaagtaatgaacagtttatatagcggtgaccctcaagac
cagcttgcagtggcttatcatcttatcattgacaatcggagaataatgaaccaagccagt
gagttctacctcgcctctagtcccccaactggttcttttatggatgatagtgccatgcat
attcccccaggcctgaaacctcatccagaaaggatgccacctcttatagcagacagcccg
aaagcaagatgtccattggatgcactgaatacaaccaagcccaaatctttagctgtaaaa
aaagccaagtggcatcttgggatccgaagtcaaagcaaaccatatgacattatggctgaa
gtttaccgagctatgaagcagctggattttgaatggaaggtagtgaatgcataccatctt
cgtgtaagaaggaaaaatccagtgactggcaattatgtgaaaatgagcttacaactttac
ctggttgacaatagaagctatcttttggactttaaaagcattgatgatgaggtggtggag
cagaggtctggttcctcaacacctcagcgttcctgttctgctgctggcttacacagacca
agatcaagttttgattctgtaactccagagagtcattcgctttctggctctcttactggc
tccttgaccggaaacacattgtcttcagttacacctcgcctgggcagtcacaccatggat
ttttttgaaatgtgtgccagtctgatcactactttagcccgttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520302
Entry
107520302         CDS       T06036                                 

Gene name
PRKAG2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04068  FoxO signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04371  Apelin signaling pathway
ray04530  Tight junction
ray04710  Circadian rhythm
ray04714  Thermogenesis
ray04910  Insulin signaling pathway
ray04920  Adipocytokine signaling pathway
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107520302 (PRKAG2)
   04068 FoxO signaling pathway
    107520302 (PRKAG2)
   04152 AMPK signaling pathway
    107520302 (PRKAG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107520302 (PRKAG2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107520302 (PRKAG2)
   04922 Glucagon signaling pathway
    107520302 (PRKAG2)
   04920 Adipocytokine signaling pathway
    107520302 (PRKAG2)
   04921 Oxytocin signaling pathway
    107520302 (PRKAG2)
  09149 Aging
   04211 Longevity regulating pathway
    107520302 (PRKAG2)
   04213 Longevity regulating pathway - multiple species
    107520302 (PRKAG2)
  09159 Environmental adaptation
   04710 Circadian rhythm
    107520302 (PRKAG2)
   04714 Thermogenesis
    107520302 (PRKAG2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107520302 (PRKAG2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107520302 (PRKAG2)
   04931 Insulin resistance
    107520302 (PRKAG2)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 107520302
NCBI-ProteinID: XP_016019404
LinkDB
Position
Unknown
AA seq 568 aa
MGSAAMDTKKKKDVCSPGGSNGKKNPSQKRRPLRVHIPDLSSFAMPLLDGDLESSEKPSS
RKVDSPSGSGSPSKGFFSRGPQHRPSSPVSAPMRPKTSPGSPKTVFPFSYQESPPRSPRR
MSFSGIFRSSSKESSPTSNASTSPGGIRFFSRSRKTSGLSSSPSTPTQVTKQHTFPLESY
KHEPERLENRIYASSPSPDTGRRLCPSPFQSSPRPPSASPGHYTPSKTAALAAAPGPAEA
GMLEKFELEEEAEDSESGVYMRFMRSHKCYDIVPTSSKLVVFDTTLQVKKAFFALVANGV
RAAPLWESKKQSFVGMLTITDFINILHRYYKSPMVQIYELEEHKIETWRELYLQETFKPL
VNISPDASLFDAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLFMSDMPKPAFM
KQNLGALGIGTYHDIAFIHPDTPIIKALSVFVERRVSALPVVDESGKVVDIYSKFDVINL
AAEKTYNNLDITVTQALRHRSQYFEGVVKCSRLELLETIVDRIVRAEVHRLVVVNDADSI
VGIISLSDILQALILTPPGAKQKEPETE
NT seq 1707 nt   +upstreamnt  +downstreamnt
atgggaagcgcggccatggacaccaagaagaagaaggacgtttgcagccccggcgggagc
aacgggaagaaaaatcccagccagaagaggcgcccgctgcgagtgcacatcccggacctg
agttccttcgccatgcccctcctggacggagacctggagagttcagagaagccttcctct
cgcaaggtggacagcccctccggctcgggcagcccctccaaggggttcttctccagaggc
ccacagcaccggccctccagccccgtgtccgcgcccatgcggcccaagaccagccccggc
tcccccaaaaccgtgttcccgttctcctaccaggagtcgcccccgcggtcccctcgccgc
atgagcttcagcgggatcttccgctcgtcctccaaagagtcgtcgcccacctccaacgca
tctacctcgcccgggggcatccgcttcttctcccgctccagaaaaacttcgggcctctcg
tcctcgccatcgacacccacccaagtgaccaagcaacacacgtttcctctcgaatcctac
aagcatgagcccgagcggctggagaatcgtatctacgcctcgtctccctctccggacacg
ggccggaggctctgcccgtctcccttccagagttccccgaggccgccgtcggcatctcca
ggacactacactccctccaaaaccgcggcgctggcggcggccccgggacccgcggaagcc
ggcatgctggagaaattcgagttggaagaagaagcagaagactcagaaagtggcgtttac
atgcgattcatgaggtcacacaagtgttacgacatcgtcccaaccagttcaaagcttgtc
gtctttgatacgaccttacaagttaagaaggccttcttcgccctagtggccaacggagtt
cgggcggcgcctctctgggagagcaaaaagcaaagctttgtaggaatgctaacaattaca
gatttcataaatattctacatagatactataaatcacccatggtacagatttatgaatta
gaggaacataagattgaaacatggagagagctttatttacaagaaacatttaagccttta
gtgaatatatctccagatgcaagcctcttcgatgctgtatactcgttgatcaaaaataaa
atccacagattgcccgtcattgaccctgtcagtgggaacgcactttacatacttacccac
aaaagaatcctcaagttcctccagctttttatgtccgacatgccgaagcctgccttcatg
aagcagaacctgggtgccctgggcatcggcacgtaccacgacatcgccttcatccacccg
gacacgcccatcatcaaggccctgagcgtcttcgtggagaggcgggtgtccgccctgccc
gtcgtcgacgagtcaggaaaagttgtagatatttattccaaattcgatgtaattaacctc
gccgccgagaaaacgtacaacaacctagacatcacggtgacccaggcgctgcggcaccgc
tcgcagtacttcgagggcgtcgtgaagtgcagcaggctggagctcctggagaccatcgtg
gacaggatagtgagggccgaggtccatcggctggtggtggtgaatgacgcggacagtatc
gtgggcatcatttccctgtcggacatcctgcaggccctgatcctcacacccccaggtgcc
aaacaaaaggagccagaaacggagtga

DBGET integrated database retrieval system