KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501037
Entry
107501037         CDS       T06036                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2 isoform X1
  KO
K09389  transcription factor E2F2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04110  Cell cycle
ray04218  Cellular senescence
ray04934  Cushing syndrome
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05212  Pancreatic cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107501037 (E2F2)
   04218 Cellular senescence
    107501037 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107501037 (E2F2)
   05206 MicroRNAs in cancer
    107501037 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107501037 (E2F2)
   05225 Hepatocellular carcinoma
    107501037 (E2F2)
   05226 Gastric cancer
    107501037 (E2F2)
   05214 Glioma
    107501037 (E2F2)
   05220 Chronic myeloid leukemia
    107501037 (E2F2)
   05218 Melanoma
    107501037 (E2F2)
   05219 Bladder cancer
    107501037 (E2F2)
   05215 Prostate cancer
    107501037 (E2F2)
   05224 Breast cancer
    107501037 (E2F2)
   05222 Small cell lung cancer
    107501037 (E2F2)
   05223 Non-small cell lung cancer
    107501037 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107501037 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107501037 (E2F2)
   05161 Hepatitis B
    107501037 (E2F2)
   05160 Hepatitis C
    107501037 (E2F2)
   05163 Human cytomegalovirus infection
    107501037 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107501037 (E2F2)
   05169 Epstein-Barr virus infection
    107501037 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107501037 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107501037 (E2F2)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    107501037 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 107501037
NCBI-ProteinID: XP_015982274
LinkDB
Position
Unknown
AA seq 436 aa
MLRGPRALAPAAGPPLKGLPAMSPTELWSPGLGSPQLYPVTTTYYTPLYPQIVPPAAAPG
TCLDATPHGPEGQAVRCVPAGRLPAKRKLDLEGIGRPAVLEFRTPKGKCIRVDGLPSPQT
PKSPGEKTRYDTSLGLLTKKFIYLLRESKDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
LIRKKAKNNIQWVSRGMFEDPTRPGKQQQLGQELKELMSMEQALDELIQSCSLNFTQLTE
DKANKRLAYVTYQDIRAVSNFKEQTVIAVKAPPQTRLEVPDSSEENLQLHLKSTQGPIEV
YLCQEEVQEPDSPAKEQLPSTSTLSPVPDFTQPSSSTNRGILEATASPAPALTSHQILSP
PPSLVPLEATDSMLELPYPLLQQTEDQFLSPTLPGSSPLINFSPPLDQDDYLWGLEGGEG
ISDLFDSYDLGDLLIN
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgctgcgagggccccgagccctggctccggccgctggaccacccctgaaggggctacct
gcgatgagccccaccgagctgtggtctcctggcctcggcagcccccagctctacccggtc
accactacctactacaccccgctgtacccgcagattgtgcctcccgctgcagcgcctggc
acctgcctggacgccaccccccacggaccggagggccaagctgtgcgatgcgtgccggct
ggccggctgccggccaaaaggaagctggacctggaggggatcgggaggcctgcggtcctg
gaatttcggactcccaaggggaagtgcattagagtggatggcctccccagcccccaaacc
cccaaatcccccggggagaagactcggtatgatacgtcactgggactgctcaccaagaag
ttcatttacctcctgagagagtccaaggatggggtcctggacctgaactgggctgccgaa
gtgctggatgtgcagaagcggcgcatctatgacatcaccaatgtgctggagggcatccag
ctcatccggaagaaggccaagaacaacatccagtgggtaagcaggggaatgtttgaagac
cccacccggcctgggaagcagcagcagctggggcaggagctgaaggagctgatgagcatg
gagcaggccttggacgagctcatccagagctgctctctgaacttcacacaactgaccgag
gacaaggccaacaagagactggcctatgtgacttaccaggacatccgtgccgtcagcaac
tttaaggagcagacggtgattgctgtcaaggctcctccacagacaagactggaagtgccc
gacagcagcgaggagaacctgcagttacatctgaagagcacgcaagggcccattgaagtc
tacctgtgccaggaggaggtgcaggaaccagacagtcctgccaaggaacaactcccctcc
acctccaccctcagccctgtccctgacttcacccagcccagcagcagcaccaaccgtggg
atcctggaagccacagcatccccagcgccagcgctgacttcccaccagatcctgtcgccg
ccaccatcccttgttcctctagaggccaccgacagcatgctggagctgccatacccactt
ctgcagcagaccgaggaccagttcctgtccccaacactgccaggcagctcccctctgatc
aacttctctccacccttggaccaggatgactacttgtggggcctggaagggggcgagggc
atcagcgacctctttgactcctatgacctcggggatctgctgattaattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501692
Entry
107501692         CDS       T06036                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3 isoform X1
  KO
K06620  transcription factor E2F3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04110  Cell cycle
ray04218  Cellular senescence
ray04934  Cushing syndrome
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05212  Pancreatic cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107501692 (E2F3)
   04218 Cellular senescence
    107501692 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107501692 (E2F3)
   05206 MicroRNAs in cancer
    107501692 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107501692 (E2F3)
   05225 Hepatocellular carcinoma
    107501692 (E2F3)
   05226 Gastric cancer
    107501692 (E2F3)
   05214 Glioma
    107501692 (E2F3)
   05220 Chronic myeloid leukemia
    107501692 (E2F3)
   05218 Melanoma
    107501692 (E2F3)
   05219 Bladder cancer
    107501692 (E2F3)
   05215 Prostate cancer
    107501692 (E2F3)
   05224 Breast cancer
    107501692 (E2F3)
   05222 Small cell lung cancer
    107501692 (E2F3)
   05223 Non-small cell lung cancer
    107501692 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107501692 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107501692 (E2F3)
   05161 Hepatitis B
    107501692 (E2F3)
   05160 Hepatitis C
    107501692 (E2F3)
   05163 Human cytomegalovirus infection
    107501692 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107501692 (E2F3)
   05169 Epstein-Barr virus infection
    107501692 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107501692 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107501692 (E2F3)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    107501692 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 107501692
NCBI-ProteinID: XP_015983591
LinkDB
Position
Unknown
AA seq 465 aa
MRKGIQPALEQYLVTAGGGEGATVVAAAAAASMDKRALLASPGLPATAAAAAAAAPGAYI
QILTTNTSTTSCSSSLQSGAVAAGPFLPSVPGAEQNAGSLLYTTPHGPSSRIGLLQQPPA
LGRGGGGGGPPAKRRLELGESGHQYLSDGLKTPKGKGRAALRNPDSPKTPKSPSEKTRYD
TSLGLLTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQ
WMGCSLSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVT
YQDIRKISGLKDQTVIVVKAPPETRLEVPDPVESLQIHLASTQGPIEVYLCPEETETHSP
MKTNNQDHNGNIPKPTSKDLASTISGHSDCSISMANLSPLASPTNLLQQTEDQIPSNLEG
PFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgagaaaggggatccagcccgccctggagcagtacctggtgaccgccgggggtggggag
ggggcgacagtcgtcgccgccgccgctgcagcctccatggacaaaagggcactgctagcc
agccccggcttacccgccaccgccgccgccgccgctgccgccgccccgggcgcgtacatc
cagatcctcaccacgaacacttccaccacctcctgttcctcctccctccagagcggcgcc
gtcgccgccggccccttcctccccagtgtccccggcgcggagcagaacgccggcagcctc
ctctacaccacgccgcacggaccctccagcagaatcgggctgctgcagcagccaccagcg
ctgggacgcggcggcggcggcggcggccctccggccaagcgaaggctggagctaggagaa
agcggtcatcagtacctctcagatggtttaaaaacccctaagggcaaagggagagctgca
ctgcgaaatccagacagtcccaaaactccaaaatctccctcagaaaaaacacggtatgat
acatcacttggtctactcaccaagaagttcattcagctactgagccaatcacctgatggg
gtcttggatttgaacaaggcagcagaggtgctgaaagtgcaaaagagaaggatttatgat
atcaccaatgtgctggaaggcatccacctcattaagaagaagtctaaaaacaacgtgcaa
tggatgggctgcagtctgtctgaggatgggggcatgctggcccagtgtcaaggcctgtca
aaggaagtgaccgagctcagtcaggaagagaagaaattagatgaactgatccaaagctgc
accctggacctcaaactgttaaccgaggattcagagaatcaaaggttagcttatgttaca
tatcaagatattcgaaaaattagtggccttaaagaccaaactgttatagttgtgaaagcc
cctccagaaacaagacttgaagtgcctgacccagtagagagcctacaaatacacttggca
agtactcaaggacccattgaggtttacttgtgtccagaagagactgaaacacatagtcca
atgaaaacaaacaaccaagaccacaatgggaatatccctaaacccacttccaaagacttg
gcttcaaccatctcaggacatagcgattgctcgatttctatggcaaacctttctcctttg
gcctccccaaccaaccttttacagcagactgaggaccaaattccttccaacctagaagga
ccgtttgtgaacttactgcctcccctgctccaagaagactatctcctaagccttggggaa
gaagaaggcatcagtgatctctttgatgcttatgatttggaaaaactcccactggtggaa
gactttatgtgtagttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519491
Entry
107519491         CDS       T06036                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04110  Cell cycle
ray04137  Mitophagy - animal
ray04218  Cellular senescence
ray04934  Cushing syndrome
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05212  Pancreatic cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    107519491 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    107519491 (E2F1)
   04218 Cellular senescence
    107519491 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519491 (E2F1)
   05206 MicroRNAs in cancer
    107519491 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107519491 (E2F1)
   05225 Hepatocellular carcinoma
    107519491 (E2F1)
   05226 Gastric cancer
    107519491 (E2F1)
   05214 Glioma
    107519491 (E2F1)
   05220 Chronic myeloid leukemia
    107519491 (E2F1)
   05218 Melanoma
    107519491 (E2F1)
   05219 Bladder cancer
    107519491 (E2F1)
   05215 Prostate cancer
    107519491 (E2F1)
   05224 Breast cancer
    107519491 (E2F1)
   05222 Small cell lung cancer
    107519491 (E2F1)
   05223 Non-small cell lung cancer
    107519491 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107519491 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107519491 (E2F1)
   05161 Hepatitis B
    107519491 (E2F1)
   05160 Hepatitis C
    107519491 (E2F1)
   05163 Human cytomegalovirus infection
    107519491 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107519491 (E2F1)
   05169 Epstein-Barr virus infection
    107519491 (E2F1)
   05165 Human papillomavirus infection
    107519491 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107519491 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107519491 (E2F1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    107519491 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 107519491
NCBI-ProteinID: XP_016017730
LinkDB
Position
Unknown
AA seq 517 aa
MGAVNVFSVTSQTANSSSARQLVALSRQKGFGAQKWPGLCRQRRPGAEREPERDQALAAA
CRNGPAPPPPPATRAPRAVRAMAVAGAPAGGPCAPALEALLGAGALRLLDSSQIVIISTA
QDASALPAPAGPAAPASGPSDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLDLETDHQ
YLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEV
LKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHAAVGISGRLEGLTQDLQQLQEDERH
LDHLIHICTTQLRLLSEDTDSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDSS
ETFQISLKSKQGPIDVFLCPEESAGGASPGKTPSQGAASGEEDRAADFATTVPPPSSPPS
SPATDPSQSLLSLEQEPLLSRMGSLRAPVDEDRLSPLVAADSLLEQVREDFSGLLPEEFI
SLSPPHGALDYHFGLEEGEGIRDLFDCDFGDLTPLDF
NT seq 1554 nt   +upstreamnt  +downstreamnt
atgggggccgttaatgtcttttccgtcacatcccagacagccaatagtagcagcgctcgg
cagctcgtggctctttcgcggcaaaaaggatttggcgcgcaaaagtggccgggactttgc
aggcagcggcggccgggggcggagcgggaaccggagcgggatcaagccctcgctgcggcc
tgccgcaatgggcccgcgccgccgccgccgcctgccacccgggccccgcgggccgtgaga
gcaatggccgtggccggggcccccgcgggcggtccatgcgcgccagcgctggaggccctg
cttggggccggcgcgctgcggctgcttgactcctcgcagatcgtcatcatctccacggcg
caggacgccagcgctctgccggcccctgccggtcctgcagcgcctgcctcgggcccctcc
gaccccgacttgctgctcttcgccacgccgcaggcgccccggcccacacccagcgctccg
cgcccggcgctcggccgcccgccggtgaagaggagactggacctggaaactgaccatcaa
tacctggctgagagcagtgggccagctcggggcagaggccgccacccaggaaaaggtgtg
aaatccccaggggagaagtcacgctatgagacatcgctgaatctgaccaccaaacgcttc
ctggagctgctgagccgctcggctgatggcgttgtcgacctgaactgggcagctgaggta
ctgaaggtgcagaaacggcgcatctatgacatcaccaacgtcctcgagggcatccagctc
atcgccaaaaagtccaagaatcacattcagtggctagggagccatgcagcagtggggatc
agtgggcggcttgaaggactgacccaggacctccagcaacttcaggaggatgaacgacac
ctggaccacctgatccacatctgtaccacgcaactgcggctgctctctgaggacactgac
agccagcgcctggcctacgtgacctgccaggatcttcgtagcattgcagaccctgccgag
cagatggtcatggtgatcaaggcccctcccgagacccagcttcaagccgtggactcctca
gagacctttcagatctcccttaagagcaaacaaggccccatcgatgttttcctgtgcccc
gaggagagtgcgggcggggccagccctggaaagaccccgtcccagggggcagcttctggg
gaggaggacagggcagctgactttgccaccacagtgccaccaccatcatctcccccatca
tcccctgccacggatcccagccagtccctgctcagcctggagcaagaacctctgctttcc
cggatgggtagcctgcgggcccctgtggacgaggaccgcctttccccgctggtggcagcc
gactcactgctggagcaagtgcgggaggacttctctggccttctccctgaggagttcatc
agcctatctcccccccacggggcccttgactaccactttggccttgaggagggcgagggc
atcagagacctctttgactgtgactttggggacctcacccctctggatttctga

DBGET integrated database retrieval system