KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501075
Entry
107501075         CDS       T06036                                 

Gene name
CCNB2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04115  p53 signaling pathway
ray04218  Cellular senescence
ray04914  Progesterone-mediated oocyte maturation
ray05166  Human T-cell leukemia virus 1 infection
ray05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    107501075 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107501075 (CCNB2)
   04114 Oocyte meiosis
    107501075 (CCNB2)
   04115 p53 signaling pathway
    107501075 (CCNB2)
   04218 Cellular senescence
    107501075 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107501075 (CCNB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107501075 (CCNB2)
   05170 Human immunodeficiency virus 1 infection
    107501075 (CCNB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ray03032]
    107501075 (CCNB2)
   03036 Chromosome and associated proteins [BR:ray03036]
    107501075 (CCNB2)
DNA replication proteins [BR:ray03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    107501075 (CCNB2)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    107501075 (CCNB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C DUF5806
Other DBs
NCBI-GeneID: 107501075
NCBI-ProteinID: XP_015982321
LinkDB
Position
Unknown
AA seq 398 aa
MALLRRPTVSTDLENIDTGVNSKTKSHVTLRRAVLEEIGNRVTTRATQVAKKAQNTKVPV
LPTRTANVNKQAKPTASVKPVQMKMLAPKAPSPTPEDISMKEENLCQAFSDALLCKIEDI
DNEDWENPQLCSDYVKDIYQYLRQLEVLQCINPHFLDGRDINGRMRAILVDWLVQVHSKF
RLLQETLYMCVAIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNA
YTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLVDYDM
VHYHPSKVAAAASCLSQKVLGQGKWNLKQQYYTGYTENDVLEVMQHMAKNIVKVNENLTK
FIAIKNKYASSKLLKISTLPQLNSKAIRELASTLMGQP
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcgctgctccgacgcccaacggtgtccaccgatttggagaatatcgatacaggagtt
aattctaaaacgaagagtcatgtgacgctccggcgggcagttttagaagaaattggaaat
agagttacaaccagagccacacaagtagctaagaaagctcagaacaccaaagtacctgtt
ttacccaccagaacagcaaatgtcaacaaacaagcgaaacctactgcttctgtgaaacca
gtacagatgaaaatgttggctccaaaggctccttctcccacacctgaggatatctccatg
aaggaagagaacctctgccaagctttctctgatgccttactctgcaaaatcgaggacatt
gataatgaagactgggaaaaccctcagctctgcagtgactacgttaaggatatctaccag
tatctaaggcagctagaggttctgcaatgcataaatccacatttcttagatggaagagat
ataaacggacgtatgcgtgccatcctggtagattggctggtgcaagtccactccaaattt
aggctgctgcaggaaactctgtacatgtgtgtcgccattatggatcgatttttacaagtt
cagccggtctctcgtaagaagcttcaactggttgggattacagccctgctcttggcttcc
aagtatgaggagatgttttctcccaatattgaagactttgtttacatcacagacaatgcg
tataccagttcccaaatccgagaaatggaaactctcattttgaaagaactgaaatttgag
ttgggtcgacctttgccactacatttcttaaggcgggcatcaaaagctggggaggttgat
gtcgaacagcacactttagccaaatatttgatggaactgactctcgttgactatgacatg
gtgcattatcacccttcgaaggtggcagctgctgcttcctgcctgtcccagaaggtttta
ggccaaggaaaatggaacttaaagcagcagtattacactggatacacagagaatgacgta
ttggaagtcatgcagcacatggccaaaaatatagtgaaagtaaatgaaaacttgacgaaa
ttcatcgccatcaagaataagtatgcaagcagcaaactcctgaagatcagcacgcttcct
cagctgaactcgaaagccatccgagagctcgcttcgactctgatgggccagccctag

DBGET integrated database retrieval system