KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501143
Entry
107501143         CDS       T06036                                 

Gene name
HSP90B1
Definition
(RefSeq) endoplasmin
  KO
K09487  heat shock protein 90kDa beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04141  Protein processing in endoplasmic reticulum
ray04151  PI3K-Akt signaling pathway
ray04657  IL-17 signaling pathway
ray04915  Estrogen signaling pathway
ray04918  Thyroid hormone synthesis
ray05132  Salmonella infection
ray05200  Pathways in cancer
ray05215  Prostate cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107501143 (HSP90B1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107501143 (HSP90B1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    107501143 (HSP90B1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107501143 (HSP90B1)
   04918 Thyroid hormone synthesis
    107501143 (HSP90B1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107501143 (HSP90B1)
  09162 Cancer: specific types
   05215 Prostate cancer
    107501143 (HSP90B1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107501143 (HSP90B1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107501143 (HSP90B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ray03110]
    107501143 (HSP90B1)
Chaperones and folding catalysts [BR:ray03110]
 Heat shock proteins
  HSP90
   107501143 (HSP90B1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 DUF4518
Other DBs
NCBI-GeneID: 107501143
NCBI-ProteinID: XP_015982486
LinkDB
Position
Unknown
AA seq 798 aa
MRALWVLGLCCVLLTFGSVRADDEVDVDGTVEEDLGKSREGSRTDDEVVQREEEAIQLDG
LNASQIRELREKSEKFAFQAEVNRMMKLIINSLYKNKEIFLRELISNASDALDKIRLISL
TDENALSGNEELTVKIKCDKEKNLLHVTDTGVGMTREELVKNLGTIAKSGTSEFLNKMTE
AQEDGQSTSELIGQFGVGFYSAFLVADKVIVTSKHNNDTQHIWESDSNEFSVIADPRGNT
LGRGTTITLVLKEEASDYLELDTIKNLVKKYSQFINFPIYVWSSKTETVEEPMDEEETAK
EEKEVEEEEEEKKPKTKKVEKTVWDWELMNDIKPIWQRPSKEVEDDEYKAFYKSFSKESD
DPMAFIHFTAEGEVTFKSILFVPTSAPRGLFDEYGSKKSDYIKLYVRRVFITDDFHDMMP
KYLNFVKGVVDSDDLPLNVSRETLQQHKLLKVIRKKLVRKTLDMIKKIADEKYNDTFWKE
FGTNIKLGVIEDHSNRTRLAKLLRFQSSHHPSDITSLDQYVERMKEKQDKIYFMAGSNRK
EAESSPFVERLLKKGYEVIYLTEPVDEYCIQALPEFDGKRFQNVAKEGVKFDESEKTKES
REATEKEFEPLLNWMKDKALKDKIEKAVVSQRLTESPCALVASQYGWSGNMERIMKAQAY
QTGKDISTNYYASQKKTFEINPRHPLIRDMLRRVKEDEDDKTVADLAVVLFETATLRSGY
LLPDTKAYGDRIERMLRLSLNIDPDAKVEEEPEEEPEETTEDTTDDTEQDEEEETDVGTD
EDEEEETAKKSTAEKDEL
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgagggccttgtgggtgctgggcctctgctgcgtgctgctgacctttgggtcagtgcga
gctgatgatgaagttgatgtggatggtacagtagaagaggatctgggtaaaagcagagaa
ggctcaaggacagatgatgaagtagtacagagagaggaagaagctattcagttggatgga
ttaaatgcatcccaaataagagagcttagagagaaatcagaaaagtttgccttccaagct
gaagtaaacagaatgatgaaacttatcatcaattcattgtataaaaataaagagattttc
ctgagagaactgatttcaaatgcttctgacgctttggataagataaggctaatatcactg
actgatgaaaatgctctttctggaaatgaggaactaacagtcaaaataaagtgtgataag
gagaagaaccttctacatgtcacagacactggtgtaggaatgacccgggaagagttggtt
aaaaaccttggcaccatagccaaatctgggacgagcgagtttttaaacaaaatgacagag
gcacaagaagatggccagtcaacctccgagttgattggccaatttggtgttggtttctat
tctgccttcctagtagcagataaggttattgtcacatcaaaacacaacaatgacacccag
cacatctgggaatccgactccaatgaattttctgtaattgctgacccaagaggaaacaca
ctgggacgtggaacaacaattacccttgttttaaaagaagaagcatctgattaccttgaa
ttggatacaattaaaaatctcgtcaaaaaatactcacagttcataaacttccctatttac
gtatggagcagcaagacagaaactgttgaggaacccatggatgaagaagaaacagcaaaa
gaagaaaaagaagtagaagaagaagaagaagaaaagaaaccaaaaacgaaaaaagttgaa
aaaactgtctgggattgggaactcatgaatgatatcaaaccaatatggcagagaccatca
aaagaagtagaagacgatgaatacaaagctttttacaaatcattttcaaaggaaagcgat
gaccccatggcttttatccactttactgccgaaggggaagttaccttcaaatcaattttg
tttgtacccacgtctgctccacgtggtctgtttgacgaatatggatctaagaagagcgat
tacattaagctgtatgtgcgccgagtattcatcacagatgatttccatgatatgatgccc
aagtaccttaactttgtcaagggtgttgtggactcagatgatctccccttgaatgtttcc
cgtgagactcttcagcaacacaaactgcttaaggtgattagaaagaagcttgtccgtaaa
actctggacatgatcaagaagattgctgatgagaaatacaatgataccttttggaaagaa
tttggtaccaacatcaagcttggtgtgattgaagaccactcaaatcgaacacgtcttgct
aaacttcttagattccagtcttctcatcatccaagtgacattactagtctagaccagtat
gtggaaagaatgaaggagaaacaagacaaaatctacttcatggctgggtccaacagaaaa
gaggccgaatcttctccatttgttgagcggcttctgaaaaagggctatgaagtgatttac
ctcacagaacctgtggatgaatactgcattcaggcccttcctgagtttgatgggaagagg
ttccagaatgttgccaaggaaggagtgaagtttgatgaaagtgagaaaactaaggagagt
cgtgaagcaactgagaaggaatttgagcccctgctcaattggatgaaagataaagccctc
aaggacaagattgaaaaggctgtggtgtcccagcgtctgactgagtctccttgcgctctg
gtggccagccagtacgggtggtctggcaacatggagagaatcatgaaagcacaagcctac
caaacaggcaaggacatctctacgaattattatgccagccagaagaaaacatttgaaatc
aatcccagacatccactgatcagagacatgcttcgacgagttaaggaagacgaagatgac
aaaacagttgcggatcttgctgtggttctgtttgaaacagcaaccctgcggtcaggatat
cttttaccagacactaaagcatatggagataggatagaaagaatgcttcgcctcagttta
aacatagaccctgatgcaaaggtcgaagaagaacccgaagaagagcctgaagaaacaacc
gaggacaccacagatgacacagagcaagacgaggaggaagaaacggatgtcggaacagac
gaagacgaagaagaagaaacagcaaagaaatctacagctgaaaaagatgaattgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501998
Entry
107501998         CDS       T06036                                 

Gene name
HSP90AB1
Definition
(RefSeq) heat shock protein HSP 90-beta
  KO
K04079  molecular chaperone HtpG
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04141  Protein processing in endoplasmic reticulum
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04612  Antigen processing and presentation
ray04621  NOD-like receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04659  Th17 cell differentiation
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray05132  Salmonella infection
ray05200  Pathways in cancer
ray05215  Prostate cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107501998 (HSP90AB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107501998 (HSP90AB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107501998 (HSP90AB1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107501998 (HSP90AB1)
   04612 Antigen processing and presentation
    107501998 (HSP90AB1)
   04659 Th17 cell differentiation
    107501998 (HSP90AB1)
   04657 IL-17 signaling pathway
    107501998 (HSP90AB1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107501998 (HSP90AB1)
   04914 Progesterone-mediated oocyte maturation
    107501998 (HSP90AB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107501998 (HSP90AB1)
  09162 Cancer: specific types
   05215 Prostate cancer
    107501998 (HSP90AB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107501998 (HSP90AB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107501998 (HSP90AB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107501998 (HSP90AB1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ray03110]
    107501998 (HSP90AB1)
   04131 Membrane trafficking [BR:ray04131]
    107501998 (HSP90AB1)
   03051 Proteasome [BR:ray03051]
    107501998 (HSP90AB1)
   03029 Mitochondrial biogenesis [BR:ray03029]
    107501998 (HSP90AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107501998 (HSP90AB1)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107501998 (HSP90AB1)
Chaperones and folding catalysts [BR:ray03110]
 Heat shock proteins
  HSP90
   107501998 (HSP90AB1)
Membrane trafficking [BR:ray04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107501998 (HSP90AB1)
Proteasome [BR:ray03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107501998 (HSP90AB1)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    107501998 (HSP90AB1)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107501998 (HSP90AB1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3
Other DBs
NCBI-GeneID: 107501998
NCBI-ProteinID: XP_015984208
LinkDB
Position
Unknown
AA seq 724 aa
MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLT
DPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLVNNLGTIAKSGTKAFMEALQAG
ADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTK
VILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEE
DKDDEEKPKIEDVGSDEEDDSAKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEE
YGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRV
FIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELA
EDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQ
KSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEG
LELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTA
NMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFE
TALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRM
EEVD
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgcctgaggaagtgcaccatggagaagaggaggtggagacttttgccttccaggcagaa
attgcccaactcatgtctctcatcatcaataccttttattccaacaaggaaattttcctt
cgggaattgattagcaatgcttctgatgccttggacaagatacgctatgagagcctgact
gacccttccaagttggacagtggtaaagagctgaaaattgacatcatccctaacccccag
gaacgcaccctgactctggtggacacaggcattggcatgaccaaagctgatctagtaaat
aatctgggaacaattgccaagtctggtactaaagcatttatggaggctcttcaggctggt
gcagacatctccatgattggacaatttggtgttgggttttattctgcttacctggtggca
gagaaagtagttgtgatcacaaagcacaatgatgatgagcagtatgcctgggagtcttct
gctgggggttccttcactgtacgagctgaccatggtgagcccattggccgaggtaccaaa
gtgatcctccaccttaaggaagaccagacagagtatttagaggagagacgggtcaaagaa
gtagtgaagaagcactcacagttcataggttatcccatcactctctatttggagaaggaa
cgagagaaagaaatcagtgatgacgaagcagaggaagagaaaggtgagaaagaagaggaa
gataaagatgatgaagagaagcccaagatagaagatgtgggctcagatgaggaggatgat
agtgctaaggataagaaaaagaaaacaaagaagataaaggagaagtatatcgatcaggaa
gaactgaacaagaccaagcccatttggaccagaaaccctgatgacattacccaggaggaa
tatggagagttctacaagagcctgaccaacgactgggaagaccacttggcagtcaagcac
ttctctgtagaaggtcagttggaattcagggcattgttattcatcccccgtcgggctcct
tttgacctttttgagaacaagaagaagaagaacaacatcaaactttatgtccgccgtgtg
ttcatcatggacagttgtgatgagttgataccagagtatctcaattttattcgtggtgtg
gttgactctgaggacttgcccctgaacatctcccgagaaatgctccagcagagcaaaatc
ttgaaggtcattcgtaaaaacattgttaagaagtgccttgagctcttctctgagctggca
gaagacaaagaaaactacaagaaattctatgaggcattctctaaaaatctaaagcttgga
atccacgaggactctactaatcgccgacgcctttctgagctgctgcgctatcacacctcc
cagtctggagatgagatgacttctctttcagaatatgtctctcgcatgaaggagactcaa
aagtccatctattacatcactggtgagagcaaagagcaagttgccaactctgcttttgtg
gagcgagtgcggaagcggggttttgaggttgtgtatatgacagagcctattgatgagtac
tgtgtgcagcagctcaaggagtttgatgggaagagcttggtctcagttaccaaggagggc
ctggaactacctgaggatgaagaggagaaaaagaaaatggaagagagcaaggccaagttt
gagaacctgtgcaaactcatgaaagaaatcttggataagaaggttgagaaggtgacaatc
tccaataggcttgtgtcttcaccctgctgcattgtgacaagcacctacggctggacagcc
aacatggagcggatcatgaaagcccaggcacttcgggacaactctacaatgggctacatg
atggccaaaaagcacctggagatcaacccggaccaccctattgtggagactctgcggcag
aaggcagaggcagacaagaatgataaggctgtcaaggaccttgtggtgctgctgtttgaa
actgcgctgctgtcttctggcttctcacttgaggatcctcagacccactccaaccgcatc
taccgtatgatcaaactaggtctaggcattgatgaagatgaagtgacagcagaagaaccc
agtgctgctgttcctgatgagatccccccccttgagggtgatgaggatgcctctcgcatg
gaagaagtagattag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521381
Entry
107521381         CDS       T06036                                 

Gene name
HSP90AA1
Definition
(RefSeq) heat shock protein HSP 90-alpha
  KO
K04079  molecular chaperone HtpG
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04141  Protein processing in endoplasmic reticulum
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04612  Antigen processing and presentation
ray04621  NOD-like receptor signaling pathway
ray04657  IL-17 signaling pathway
ray04659  Th17 cell differentiation
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray05132  Salmonella infection
ray05200  Pathways in cancer
ray05215  Prostate cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107521381 (HSP90AA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107521381 (HSP90AA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107521381 (HSP90AA1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107521381 (HSP90AA1)
   04612 Antigen processing and presentation
    107521381 (HSP90AA1)
   04659 Th17 cell differentiation
    107521381 (HSP90AA1)
   04657 IL-17 signaling pathway
    107521381 (HSP90AA1)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107521381 (HSP90AA1)
   04914 Progesterone-mediated oocyte maturation
    107521381 (HSP90AA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107521381 (HSP90AA1)
  09162 Cancer: specific types
   05215 Prostate cancer
    107521381 (HSP90AA1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107521381 (HSP90AA1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107521381 (HSP90AA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107521381 (HSP90AA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ray03110]
    107521381 (HSP90AA1)
   04131 Membrane trafficking [BR:ray04131]
    107521381 (HSP90AA1)
   03051 Proteasome [BR:ray03051]
    107521381 (HSP90AA1)
   03029 Mitochondrial biogenesis [BR:ray03029]
    107521381 (HSP90AA1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107521381 (HSP90AA1)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107521381 (HSP90AA1)
Chaperones and folding catalysts [BR:ray03110]
 Heat shock proteins
  HSP90
   107521381 (HSP90AA1)
Membrane trafficking [BR:ray04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107521381 (HSP90AA1)
Proteasome [BR:ray03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107521381 (HSP90AA1)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    107521381 (HSP90AA1)
Exosome [BR:ray04147]
 Exosomal proteins
  Proteins found in most exosomes
   107521381 (HSP90AA1)
SSDB
Motif
Pfam: HSP90 HATPase_c HATPase_c_3 LOH1CR12 Zip
Other DBs
NCBI-GeneID: 107521381
NCBI-ProteinID: XP_016021504
LinkDB
Position
Unknown
AA seq 732 aa
MPEETQAQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDKIR
YESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAFME
ALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGEPM
GRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEKED
KEEEKEKEEKDSEDKPEIEDVGSDEEEEEKKDGDKKKKKIKEKYIDQEELNKTKPIWTRN
PDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKKNN
IKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVKKC
LELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLKDY
CTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEGKT
LVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCCIV
TSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKSVK
DLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDSSAAVTEEMPPLE
GDDDTSRMEEVD
NT seq 2199 nt   +upstreamnt  +downstreamnt
atgccggaggagacccaggcccaagaccagccgatggaggaggaggaggttgagacgttc
gccttccaggcggagatcgcccagttgatgtcgttgatcatcaatactttttactcgaat
aaggagatctttctgagggagcttatttcaaattcatcggatgctctggacaaaatcaga
tatgaaagcttgacagatcccagtaagctagactctgggaaagagttgcacattaatctc
attccgaacaaacaagatcggaccctcaccattgtagacactgggattggaatgaccaag
gccgacttgatcaataaccttggtactatcgccaagtctgggaccaaagcgttcatggaa
gctttgcaggccggtgcagacatctccatgattggccagtttggtgttgggttttactct
gcctatctggttgccgaaaaagtgacggtgatcaccaaacacaatgatgacgagcagtat
gcctgggaatcttccgccggagggtcgttcacagttaggactgacacaggggaacccatg
ggtcgtggaacaaaggtgatcctgcacctgaaagaagaccaaacggagtacctggaggag
aggaggatcaaggagatcgtgaagaagcactcccagtttatcggctaccccatcactctc
tttgtggagaaggaacgcgacaaagaagtcagtgatgatgaggccgaagaaaaggaagac
aaagaggaagagaaagaaaaagaagaaaaggattcggaggacaaacctgaaatagaagac
gtcgggtctgatgaggaggaggaagaaaagaaggacggtgacaagaagaagaagaagatc
aaggagaagtacatcgatcaggaagagctgaacaagacaaagccgatctggaccaggaac
cctgacgacatcaccaatgaggagtacggggagttctacaagagcctcaccaacgactgg
gaggaccacctggcggtgaagcatttttcagtggagggacagttggaattcagagccctt
cttttcgttccaagacgcgctcccttcgatctgttcgaaaacagaaagaaaaagaacaac
atcaagttgtatgtccgcagagttttcatcatggataactgcgaggagctgatccctgag
tacctgaatttcatcagaggtgtggtggactctgaggatctccctctaaatatttcccgg
gagatgttacaacaaagcaagattttgaaagttatcagaaagaatttggtcaaaaaatgc
ttggaacttttcactgagctggcagaagataaagagaactataaaaagttttatgagcag
ttttctaaaaacattaagctgggaatccatgaagattctcagaaccggaagaagctctcg
gagctgttgagatactacacctccgcctcgggcgacgagatggtttcgctcaaggactac
tgcacgaggatgaaggagaaccagaagcacatctactacatcacaggtgagaccaaggac
caggtcgcgaactcggccttcgtggagcgcctgcgcaagcacggcctagaggtgatctac
atgatcgagccgatcgacgagtactgcgtccagcagctgaaggagttcgagggcaagacg
ttagtgtcagtcaccaaagagggcctggagcttccagaagatgaagaagagaagaagaaa
caggaagagaagaaaacaaagtttgaaaacctctgcaaaatcatgaaggacatcttggag
aaaaaagtagaaaaggtggtggtgtcaaaccggttggtgacgtccccatgctgcattgtc
acgagcacatacggctggacagcaaacatggaaagaatcatgaaagctcaggctctgaga
gacaactccaccatgggttacatggcggcaaagaaacatctggagataaaccccgaccac
tccatcatcgagaccttgaggcagaaggcggaggccgacaagaacgacaagtcggtgaag
gacctggtcatcctgctctacgaaactgcgctgctgtcgtccggcttcagtctggaagac
ccccagacccacgcgaacaggatctacaggatgatcaaactgggtctcggtatcgacgag
gatgaccccactgctgacgacagcagcgccgctgtcaccgaagagatgccgcccctggaa
ggggacgacgacacctcccgcatggaggaagtagactga

DBGET integrated database retrieval system