KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501166
Entry
107501166         CDS       T06036                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I isoform X1
  KO
K05459  insulin-like growth factor 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04114  Oocyte meiosis
ray04115  p53 signaling pathway
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04213  Longevity regulating pathway - multiple species
ray04510  Focal adhesion
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04913  Ovarian steroidogenesis
ray04914  Progesterone-mediated oocyte maturation
ray04935  Growth hormone synthesis, secretion and action
ray04960  Aldosterone-regulated sodium reabsorption
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05205  Proteoglycans in cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05224  Breast cancer
ray05410  Hypertrophic cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107501166 (IGF1)
   04014 Ras signaling pathway
    107501166 (IGF1)
   04015 Rap1 signaling pathway
    107501166 (IGF1)
   04066 HIF-1 signaling pathway
    107501166 (IGF1)
   04068 FoxO signaling pathway
    107501166 (IGF1)
   04151 PI3K-Akt signaling pathway
    107501166 (IGF1)
   04152 AMPK signaling pathway
    107501166 (IGF1)
   04150 mTOR signaling pathway
    107501166 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107501166 (IGF1)
   04115 p53 signaling pathway
    107501166 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107501166 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107501166 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    107501166 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    107501166 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    107501166 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    107501166 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    107501166 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107501166 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    107501166 (IGF1)
   04213 Longevity regulating pathway - multiple species
    107501166 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107501166 (IGF1)
   05202 Transcriptional misregulation in cancer
    107501166 (IGF1)
   05205 Proteoglycans in cancer
    107501166 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    107501166 (IGF1)
   05218 Melanoma
    107501166 (IGF1)
   05215 Prostate cancer
    107501166 (IGF1)
   05224 Breast cancer
    107501166 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107501166 (IGF1)
   05414 Dilated cardiomyopathy
    107501166 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107501166 (IGF1)
   01522 Endocrine resistance
    107501166 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107501166 (IGF1)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107501166 (IGF1)
SSDB
Motif
Pfam: Insulin DUF2865
Other DBs
NCBI-GeneID: 107501166
NCBI-ProteinID: XP_015982541
LinkDB
Position
Unknown
AA seq 169 aa
MGKISSLPTQLFKCCFCDFLKVKMHIMSSSHVFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPMGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKAQKYQPPSTNKKTKSQRKKEVHLKNASRGSAGNKNYRM
NT seq 510 nt   +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacatcatgtcctcctcgcacgtcttctacctggccttgtgcttgctc
accttcaccagctccgccacggctggaccggagacactctgtggggctgagctggtggac
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccatgggatatggc
tccagcagccggagggcacctcagacaggcattgtggatgagtgctgcttccggagctgt
gacctgaggaggctggagatgtactgcgcgccccttaagcctgccaagtcggcccgctcc
gtccgtgcccagcgccacaccgacatgcccaaggctcagaagtatcagcccccatctacc
aacaagaaaacgaagtctcagaggaaaaaggaagtacatttgaagaatgcaagtagaggg
agtgcgggaaataagaactacagaatgtag

DBGET integrated database retrieval system