KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501194
Entry
107501194         CDS       T06036                                 

Gene name
ROCK2
Definition
(RefSeq) LOW QUALITY PROTEIN: rho-associated protein kinase 2
  KO
K17388  Rho-associated protein kinase 2 [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04071  Sphingolipid signaling pathway
ray04270  Vascular smooth muscle contraction
ray04310  Wnt signaling pathway
ray04360  Axon guidance
ray04510  Focal adhesion
ray04530  Tight junction
ray04611  Platelet activation
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray04921  Oxytocin signaling pathway
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107501194 (ROCK2)
   04071 Sphingolipid signaling pathway
    107501194 (ROCK2)
   04024 cAMP signaling pathway
    107501194 (ROCK2)
   04022 cGMP-PKG signaling pathway
    107501194 (ROCK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107501194 (ROCK2)
   04530 Tight junction
    107501194 (ROCK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107501194 (ROCK2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107501194 (ROCK2)
   04670 Leukocyte transendothelial migration
    107501194 (ROCK2)
   04062 Chemokine signaling pathway
    107501194 (ROCK2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107501194 (ROCK2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107501194 (ROCK2)
  09158 Development and regeneration
   04360 Axon guidance
    107501194 (ROCK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107501194 (ROCK2)
   05205 Proteoglycans in cancer
    107501194 (ROCK2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107501194 (ROCK2)
   05135 Yersinia infection
    107501194 (ROCK2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107501194 (ROCK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107501194 (ROCK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107501194 (ROCK2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107501194 (ROCK2)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   107501194 (ROCK2)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107501194 (ROCK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 Cortex-I_coil APH
Other DBs
NCBI-GeneID: 107501194
NCBI-ProteinID: XP_015982582
LinkDB
Position
Unknown
AA seq 1410 aa
MSRPAPAGKMPGAPEDPQGDGAGASRQRKLEALIRDPRSPVNVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAXVIGRGAFGEVQLVRHKASQKVYAMKLLSKF
EMIKRSDSAFFWEERDIMAFANSPWVVQLFCAFQDDKYLYMVMEYMPGGDLVNLMSNYDV
PEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMDETGMVH
CDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLFEMLVGDTPFYADSLVGTYSKI
MDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIKQHPFFKNDQWNWDNIRE
TAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENLLLSDSP
SCRENDSLQSRKNEESQEIQKKLYTLEEHLSTEIQAKEELEQKCRSINTRLEKVAKELEE
EITLRKNVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQLEDLKKR
NQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNRDLQDKN
CLLETAKLKLEKEFINLQSVLESERRDRTHGSEIISDLQGRISGLEEDLKNGKILLTKVE
MEKRQLHERFTDLEKEKSNMEIDMTYQLKVMQQSLEQEEAEHKATKARLADKNKIYESIE
EAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSILDCDFKQSQQKINELLKQKDVLN
EDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMSLEKQNA
ELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKVCKELQQKKQELQD
ERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQELTEKDA
TIASLEETNRTLTSDVANLANEKEELNNKLKDAQEQLSRLKDEEISAAAIKAQFEKQLLT
ERTLKTQAVNKLAEIMNRKEPVRRGNDTDVRRKEKENRKLHMELKSEREKLTQQMIKYQK
ELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGMDSSSTGSGPGDAEADD
GFPESRLEGWLSLPVRNNTKKFGWVRKYVIVSSKKILFYDSEQDKEQSNPYMVLDIDKLF
HVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKGHEFIPT
LYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYDISTAKN
LLILANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSRQLAPNK
PRLLDLAFKDWDWSFDDVDGGDDDDDVFDF
NT seq 4233 nt   +upstreamnt  +downstreamnt
atgagccggcccgcgcccgcggggaaaatgcccggcgcccccgaggacccgcagggggac
ggggcgggcgcgagccgccagaggaagctggaggcgctgatccgagaccctcgctcgccc
gtcaacgtggagagcctgctggatggcttaaattccttggtccttgatttggattttcct
gctttgaggaaaaacaagaatatagataatttcttaaatagatatgaaaaaattgtgaaa
aaaatcagaggtctgcagatgaaggcannagttattggaagaggtgcttttggtgaagtc
cagttggttcgtcataaggcatcacagaaggtttatgctatgaagcttcttagtaagttt
gaaatgataaaaagatcagattctgcttttttctgggaagaaagagatattatggccttt
gccaacagtccctgggtggttcagctcttctgtgcctttcaagatgataagtatctgtat
atggtaatggagtacatgcctggtggagaccttgtaaaccttatgagtaactatgatgta
cctgaaaaatgggccaaattttatactgctgaagtcgttcttgctctggatgccatacac
tccatgggtttaattcacagagatgtgaagcctgacaacatgctcttggataaacatgga
catctaaaattagcagattttggcacatgtatgaagatggacgaaacaggcatggtgcat
tgtgatacagcagtcggaacacctgattatatctcacctgaggttttgaaatcacaagga
ggcgatggttactatgggcgagaatgtgattggtggtctgtgggtgttttcctttttgag
atgctggtgggggatacaccattttatgcagattcacttgttggaacatatagcaaaatt
atggatcataaaaactcactgtgtttccctgaagatgcagaaatttctaaacatgcaaag
aatctcatctgtgccttcctaacggatagggaggtacgacttgggagaaatggggtagaa
gaaatcaaacaacatcctttttttaagaatgaccagtggaattgggataacataagagag
acggcagctccggtagtacctgaactcagcagtgacatagacagcagcaattttgatgac
attgaagatgataaaggagatgtggaaaccttcccaattcctaaagcttttgtgggaaat
cagctgccttttataggatttacctactacagggaaaatttgttactaagtgactctcca
tcttgtagagaaaatgattcactacaatcaaggaagaatgaagaaagtcaagagattcag
aaaaaactgtacacattagaagaacaccttagcactgagatacaagccaaagaggagctg
gaacagaagtgcaggtctattaacactcgcctagagaaagtagcaaaggagctggaagaa
gagattaccttaaggaaaaatgtggaatcagcattaaggcaattagaaagagaaaaggcg
cttcttcagcacaaaaatgcagagtatcagaggaaagctgatcatgaagcagacaagaaa
cgaaatttggagaatgatgttaacagtttaaaagatcaacttgaagatttgaaaaaaaga
aatcagaactctcaaatatccaccgagaaagtgaatcaactccagagacaactggatgaa
accaatgctttgctgcgaacagaatctgatactgcagcccggttaagaaaaacccaggca
gaaagttcaaaacagattcagcagctggaatctaacaatagagatctacaagataaaaac
tgcctcctggagactgccaagttaaaacttgaaaaggagtttatcaatcttcagtcggtt
ctagaatctgaaaggagggaccgaacccatggatcagagataatcagcgatttacaaggt
agaatatctggcctagaagaagacttaaagaatggcaaaatcttattaacaaaggtagag
atggagaagagacagctgcatgagagatttactgacttggaaaaggaaaagagcaacatg
gaaatagatatgacataccaactgaaagttatgcagcagagcttagagcaagaagaagca
gaacacaaggctacaaaagcgcggctggcagataaaaataagatttacgaatccatcgaa
gaagctaagtcagaagccatgaaagaaatggaaaagaagctgttggaagaaaggacttta
aagcaaaaagtggagaacctgttgctcgaagctgagaaaaggtgttctattttagactgt
gacttcaaacagtcacagcagaaaataaatgaacttctgaaacaaaaagatgtgctaaat
gaggacgttagaaacttgacattaaaaatagagcaggaaactcagaagcgctgccttaca
caaaatgacttgaagatgcaaacacagcaagttaacacactaaaaatgtcagaaaagcag
ttaaaacaagaaaataatcatctcatggaaatgaaaatgagcttggaaaaacagaatgct
gaacttcgaaaagaacgtcaagacgcagatgggcaaatgaaagagctccaagatcaactt
gaagcggaacagtatttctcaactctctataaaacacaggttagggaacttaaagaagaa
tgtgaagaaaagaccaaagtttgtaaagaattacagcagaagaaacaggaattacaggac
gaaagggactccttggctgctcaactggagatcaccttgaccaaagcagattctgagcag
ctggctcgttcaattgccgaagaacaatattctgatttggaaaaagagaaaatcatgaaa
gagctggagatcaaagagatgatggctaggcacaaacaagaactcactgaaaaagatgct
acaattgcatctctcgaagaaactaacaggacactaactagtgatgttgccaatcttgca
aatgagaaagaagaattaaataacaaactgaaagatgcccaagaacagctgtcaaggttg
aaagatgaagagataagtgccgcagctattaaagcgcaatttgagaagcagctgttaaca
gagagaacactcaaaactcaagctgtgaataagttggctgagatcatgaatcgaaaagaa
cctgtcaggcgtggtaatgacacagacgtgcggagaaaagagaaggagaacagaaagcta
cacatggagcttaaatctgaacgtgagaagctgacccagcagatgatcaagtatcagaaa
gaactgaatgaaatgcaggctcaaatagctgaagagagccagattcggatcgaactgcag
atgaccttggacagtaaagacagcgacattgagcagctccggtcgcaactccaggccttg
catattggtatggacagttcgagcacaggcagcgggccaggggatgccgaggcagatgac
gggtttccagaatcaagactagaggggtggctctcactgcctgtgagaaacaacaccaag
aaattcggatgggtcagaaagtatgtgattgtcagcagtaagaagattcttttctatgac
agtgaacaagataaagaacaatctaatccttacatggttttagatatagataagttgttt
catgtccgaccagtcacacagacagatgtatatagagcagatgctaaagaaattccaagg
atatttcagattctgtatgccaatgaaggagaaagtaagaaggaacaagaatttccagtg
gagccagtgggagaaaaatcaaattatatttgccacaagggacatgaatttattcctact
ctctatcattttcctaccaactgtgaggcttgtatgaagccgttgtggcatatgtttaag
ccgcctcctgctttagagtgccgccgctgccatatcaaatgtcataaagaccacatggac
aaaaaggaggagattatagcaccttgcaaagtgtattatgatatttcaacggcaaagaat
ctattaatattagcaaattctacagaagagcagcaaaagtgggttagtcgattggtgaaa
aagatacccaaaaagcctccagccccagacccctttgcacggtcctctcccagaacttca
atgaagatccagcaaaaccagtctattagacggccaagtcgacagcttgccccaaacaaa
ccaagattacttgatttggcttttaaagactgggattggtcatttgatgatgttgatggt
ggtgatgatgatgacgatgtttttgatttctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520580
Entry
107520580         CDS       T06036                                 

Gene name
ROCK1
Definition
(RefSeq) rho-associated protein kinase 1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04071  Sphingolipid signaling pathway
ray04270  Vascular smooth muscle contraction
ray04350  TGF-beta signaling pathway
ray04360  Axon guidance
ray04510  Focal adhesion
ray04530  Tight junction
ray04611  Platelet activation
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray04921  Oxytocin signaling pathway
ray05135  Yersinia infection
ray05163  Human cytomegalovirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107520580 (ROCK1)
   04071 Sphingolipid signaling pathway
    107520580 (ROCK1)
   04024 cAMP signaling pathway
    107520580 (ROCK1)
   04022 cGMP-PKG signaling pathway
    107520580 (ROCK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107520580 (ROCK1)
   04530 Tight junction
    107520580 (ROCK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107520580 (ROCK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107520580 (ROCK1)
   04670 Leukocyte transendothelial migration
    107520580 (ROCK1)
   04062 Chemokine signaling pathway
    107520580 (ROCK1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107520580 (ROCK1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107520580 (ROCK1)
  09158 Development and regeneration
   04360 Axon guidance
    107520580 (ROCK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107520580 (ROCK1)
   05206 MicroRNAs in cancer
    107520580 (ROCK1)
   05205 Proteoglycans in cancer
    107520580 (ROCK1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107520580 (ROCK1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107520580 (ROCK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107520580 (ROCK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107520580 (ROCK1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107520580 (ROCK1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   107520580 (ROCK1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107520580 (ROCK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Rho_Binding PH C1_1 HR1 APH Pkinase_C
Other DBs
NCBI-GeneID: 107520580
NCBI-ProteinID: XP_016020031
LinkDB
Position
Unknown
AA seq 1354 aa
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDLWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNA
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
AQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
KEYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNIERVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMYEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKHLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTLSRLEETNSMLTKDIELLRKENE
ELTDKTREAEEEYKLKKEEEINNLKAAFEKNINTERTLKIQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSIPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGESRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS
NT seq 4065 nt   +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcggtttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcggattgtttgctggatggattggatgctttggtgtatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttttaagcagatataaa
gacacaataaataaaattagagatttacgaatgaaagctgaagattatgaagtggtgaag
gtgattggtagaggtgcatttggagaagttcaattggtaaggcataaatctaccaggaag
gtatatgctatgaagcttctcagcaaatttgaaatgattaagagatccgattctgctttt
ttctgggaagaaagagacatcatggcttttgctaacagtccttgggttgttcagcttttt
tatgcattccaagatgatcgttacctctacatggtgatggaatacatgcctggtggagat
cttgtaaacttaatgagcaactatgatgtgccggaaaaatgggcacgattctatactgca
gaagtagttcttgcattggatgcaatccattccatgggttttattcatagagatgtgaag
cctgataacatgctgctggataaatctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggtatggtacgatgtgatacagcagttggaacacctgattat
atttcccccgaagtattaaaatctcaaggtggtgatggttattatggacgagaatgtgac
tggtggtcagttggggtatttttatatgaaatgcttgtaggtgatacacctttttatgca
gattctctggttggaacttatagtaagattatgaaccataagaattcacttaccttccct
gatgataatgacatatcaaaagaagccaaaaatcttatttgtgcctttcttaccgacagg
gaggtgagattagggcgaaatggtgtagaagaaatcaaacgacatctcttcttcaaaaat
gatctgtgggcttgggaaacacttcgagacactgtagcaccagttgttcctgatttaagt
agtgacattgatacaagtaacttcgatgacttggaagaagataaaggagatgaggaaaca
ttccccatacctaaagcttttgttggcaatcaactaccttttgtaggatttacatattac
agcaatcgtagatacttatcttcagcaaatcctaatgataacagaactagctccaatgca
gataaaagcttgcaggaaagtttgcaaaaaacaatttataagctggaagaacagctgcat
aatgaaatgcaattaaaagatgaaatggagcagaagtgcagaacttcaaacataaaacta
gacaagataatgaaagaattggacgaagaggggaatcaaagaagaaatctagaatctaca
gtgtctcagattgagaaagagaaaatgttgcttcaacatagaattaatgagtaccaaaga
aaagcagaacaggaaaatgagaagagacgaaatgtagaaaatgaagtttctacattaaag
gatcagttggaagacttaaagaaagtaagtcagaattcacagcttgctaatgagaagctg
gcacaattacaaaagcagctagaagaagccaatgacttactcaggacagaatcagacaca
gctgtaagattaaggaagagtcacacagagatgagcaagtcaattagtcagctagagtcc
ctgaacagagaattacaggagagaaatagaattttagagaattccaagtcacaaacggac
aaagaatattaccagctgcaagctgtgttagaagctgaacgaagagacagaggtcatgat
tctgagatgatcggagaccttcaagctcgaattacctctttacaagaggaggtgaagcat
ctcaaacataatattgaaagagtagaaggagaaagaaaagaggctcaagacatgcttaat
cattcagaaaaggaaaagaataatttagagatagatttaaactacaagcttaaatcatta
caacaacggttagaacaagaggtaaatgaacataaagtaaccaaagctcgtttaactgac
aaacatcaatctattgaagaggcaaagtctgttgcaatgtacgagatggaaaaaaaactg
aaggaagagagagaagctcgagagaaggctgaaaatagggttgttcagattgagaaacag
tgttccatgctagatgttgatctgaaacaatctcagcagaagctcgagcatttgactgag
aataaagaaaggatggaagatgaagttaagcatctcacgctgcaattggagcaggaatca
aataaacgactgttgttacaaaatgaattgaagactcaagcatttgaggcagacaattta
aaaggtctagaaaagcagatgaaacaggaaataaatactttattagaagcaaagagatta
ttagaatttgagttagctcagcttacaaaacaatatagaggaaatgaaggacagatgcgg
gaactgcaagaccagcttgaagcagagcagtatttctcgacactttataaaacccaggta
aaggaacttaaggaagaaattgaagaaaaaaacagagaaaatttaaagaaaatacaggaa
ctacaaaatgagaaagaaactcttgctactcagttggatctagcagaaacaaaagctgag
tctgagcagttggctcgagggcttctggaagaacagtactttgaattgacacaagaaagc
aagaaagctgcttccagaaatagacaagagattacagataaagatcacactcttagtcgg
cttgaagaaacaaacagcatgctaaccaaagatattgaattattaagaaaagaaaatgaa
gaactaactgataaaacaagggaggcagaagaagaatataaattgaagaaggaggaggag
atcaataatcttaaggctgcctttgaaaagaatatcaatacagaacgaacccttaaaata
caggccgttaacaagttggcagaaataatgaatcgaaaagattttaaaattgatagaaag
aaagctaatacacaagatttgagaaagaaggaaaaggaaaatcgaaagctacaactggaa
ctcaaccaagaaagagagaaattcaaccagatggtagtgaagcatcaaaaggaactaaat
gacatgcaagcgcaattggtagaagaatgtacacataggaatgagcttcagatgcagttg
gctagcaaagagagtgatattgagcaattgcgtgctaaacttttggacctttcggattct
acaagtgttgctagttttcctagtgctgatgaaactgatggaaaccttccagagtcaaga
attgaaggttggctttcaataccaaatagaggaaatataaaacgatatggctggaagaaa
cagtatgttgtggtaagcagcaaaaaaattttattttataacgatgaacaagataaggag
caatccaatccatctatggtgttggacatagataaattgtttcatgttcgacctgtaacc
caaggagatgtatacagagctgaaactgaagaaattcctaaaatattccagatactatat
gcaaatgaaggtgaaagtagaaaagatgtagagatggaaccagtacaacaagctgaaaaa
acaaattttcaaaatcacaaaggccacgagttcattcctacactctaccactttcccgcc
aactgtgaggcctgtgccaaacctctctggcatgtttttaagccacctcctgccttagaa
tgtcgaagatgccatgtgaagtgccacagagatcacttagataagaaagaggacttaatt
tccccatgtaaagtaagttatgatgtaacatcagcaagagatatgctgttgttagcatgt
tctcaggatgaacaaaaaaaatgggtaactcatttagtaaagaagatacctaaaaatcca
ccatctggctttgttcgtgcatcccctcgaacactttctacaagatccactgcaaatcag
tctttccggaaagtggtcaaaaatacatctggaaaaactagttaa

DBGET integrated database retrieval system