KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501225
Entry
107501225         CDS       T06036                                 

Gene name
PLA2G1B
Definition
(RefSeq) phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04270  Vascular smooth muscle contraction
ray04972  Pancreatic secretion
ray04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107501225 (PLA2G1B)
   00565 Ether lipid metabolism
    107501225 (PLA2G1B)
   00590 Arachidonic acid metabolism
    107501225 (PLA2G1B)
   00591 Linoleic acid metabolism
    107501225 (PLA2G1B)
   00592 alpha-Linolenic acid metabolism
    107501225 (PLA2G1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107501225 (PLA2G1B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107501225 (PLA2G1B)
  09154 Digestive system
   04972 Pancreatic secretion
    107501225 (PLA2G1B)
   04975 Fat digestion and absorption
    107501225 (PLA2G1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107501225 (PLA2G1B)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107501225 (PLA2G1B)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107501225 (PLA2G1B)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N DUF1644 Phospholip_A2_2
Other DBs
NCBI-GeneID: 107501225
NCBI-ProteinID: XP_015982637
LinkDB
Position
Unknown
AA seq 148 aa
MKLLVLAALLTVGASGSGVSPRALWQFRSMIKCTIPSSDPFRDYNDYGCYCGLGGSGTPV
DELDKCCQTHDQCYDQAKKLESCTFLLDNPYTKSYSYSCSGSEITCSSKNKACQAFICNC
DRAAAICFSKAPYNKAHKDLDTKKYCQD
NT seq 447 nt   +upstreamnt  +downstreamnt
atgaaactccttgtgctggctgctctgctcacagtgggcgcttccggaagtggggtgtcc
ccgcgggcattgtggcagttccgcagcatgatcaaatgcacgatccccagcagtgacccc
tttagagattacaacgactatggctgctattgtggcctgggtggatccggcaccccagtg
gatgaactggacaagtgctgtcagacacacgaccaatgctacgaccaagccaagaaactg
gaaagctgcacatttctcctggacaacccctatactaaaagctactcgtactcttgctct
ggttcagagatcacctgcagcagcaaaaacaaagcatgccaggccttcatctgcaactgc
gaccgcgctgctgccatctgcttttcaaaggccccgtacaacaaggctcacaaggatctg
gacaccaagaagtattgtcaagactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501776
Entry
107501776         CDS       T06036                                 

Gene name
PLA2G2D
Definition
(RefSeq) group IID secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04270  Vascular smooth muscle contraction
ray04972  Pancreatic secretion
ray04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107501776 (PLA2G2D)
   00565 Ether lipid metabolism
    107501776 (PLA2G2D)
   00590 Arachidonic acid metabolism
    107501776 (PLA2G2D)
   00591 Linoleic acid metabolism
    107501776 (PLA2G2D)
   00592 alpha-Linolenic acid metabolism
    107501776 (PLA2G2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107501776 (PLA2G2D)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107501776 (PLA2G2D)
  09154 Digestive system
   04972 Pancreatic secretion
    107501776 (PLA2G2D)
   04975 Fat digestion and absorption
    107501776 (PLA2G2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107501776 (PLA2G2D)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107501776 (PLA2G2D)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107501776 (PLA2G2D)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 107501776
NCBI-ProteinID: XP_015983729
LinkDB
Position
Unknown
AA seq 148 aa
MELLHLYLLVVFAGVCPTQGGIQNLNKMVTHMTEKTPIISYWFYGCHCGLGGRGPPLDAT
DRCCHAHDCCYAHLRHHRCRIHTDLYSYNFSHGDIHCSDKGTWCEQELCACDKEVAFCLQ
RHLGSYKKELRFTRQFRPSRCKGKTPMC
NT seq 447 nt   +upstreamnt  +downstreamnt
atggagcttctccacttgtacctgctggtggtgtttgctggtgtgtgtccaacccaaggc
gggattcagaacttgaacaagatggtcacacacatgactgagaagacacccatcatctcc
tattggttctacggctgtcactgtggcctcgggggcagaggcccacccctagatgccaca
gaccggtgctgccatgcccatgactgctgctatgctcacctgaggcatcaccgttgccgt
atacacacggacctttacagctataacttctcccacggggacatccattgctctgacaag
ggaacctggtgtgagcaggagctgtgcgcctgtgacaaggaggtggccttctgcctgcag
cgtcacctgggcagctacaagaaggagctgcgtttcacccgtcaattccggccatcccgc
tgcaagggcaagacgcctatgtgctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501788
Entry
107501788         CDS       T06036                                 

Gene name
PLA2G2F
Definition
(RefSeq) group IIF secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04270  Vascular smooth muscle contraction
ray04972  Pancreatic secretion
ray04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107501788 (PLA2G2F)
   00565 Ether lipid metabolism
    107501788 (PLA2G2F)
   00590 Arachidonic acid metabolism
    107501788 (PLA2G2F)
   00591 Linoleic acid metabolism
    107501788 (PLA2G2F)
   00592 alpha-Linolenic acid metabolism
    107501788 (PLA2G2F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107501788 (PLA2G2F)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107501788 (PLA2G2F)
  09154 Digestive system
   04972 Pancreatic secretion
    107501788 (PLA2G2F)
   04975 Fat digestion and absorption
    107501788 (PLA2G2F)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107501788 (PLA2G2F)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107501788 (PLA2G2F)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107501788 (PLA2G2F)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N
Other DBs
NCBI-GeneID: 107501788
NCBI-ProteinID: XP_015983741
LinkDB
Position
Unknown
AA seq 211 aa
MAGGAQANPKGCRRKVLGRYSSRWRGPSLKASSPVRTSRSSLAMRTFFTIAILAGSILAV
AHGSLFNLKSMVEAVTGKSAILTFVGYGCYCGLGGRGLPMDEVDWCCHAHDCCYQKLFDQ
GCRPYVDNYEYTLDGNATIACRDLNETECDRQTCECDKSIVLCLQNQTYNEEHRNYLNIY
CQGTTPNCSIYEQPQKKEACRPVSQAPPIPP
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcaggtggggcgcaggccaaccccaaagggtgcaggaggaaggtgctgggtagatat
tcctctaggtggaggggcccgagtctcaaggcctcttctcctgtgaggacctccagatct
agcctggctatgagaacgttcttcaccatcgccatcctggctggcagcatcttggctgtg
gcccacggcagcctgttcaacctgaagtccatggtggaagccgtcacggggaaaagtgcc
atcctgaccttcgtaggctacggctgctactgtgggctgggagggcgcggcctgcccatg
gacgaagtggactggtgctgccatgcccacgactgctgctaccagaagctgtttgaccag
ggctgtcgcccctacgtggacaactatgaatacaccctcgacggcaatgctacaattgct
tgcagagatctcaacgagactgagtgtgacaggcagacctgtgagtgtgacaagagtata
gttctgtgcttacagaaccagacctacaacgaggagcaccgcaactacctcaacatctac
tgccagggcaccacgcccaactgcagcatctacgagcaacctcagaagaaggaagcctgc
aggcctgtctcccaggcgccccctatacctccctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501789
Entry
107501789         CDS       T06036                                 

Gene name
PLA2G2E
Definition
(RefSeq) group IIE secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04270  Vascular smooth muscle contraction
ray04972  Pancreatic secretion
ray04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107501789 (PLA2G2E)
   00565 Ether lipid metabolism
    107501789 (PLA2G2E)
   00590 Arachidonic acid metabolism
    107501789 (PLA2G2E)
   00591 Linoleic acid metabolism
    107501789 (PLA2G2E)
   00592 alpha-Linolenic acid metabolism
    107501789 (PLA2G2E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107501789 (PLA2G2E)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107501789 (PLA2G2E)
  09154 Digestive system
   04972 Pancreatic secretion
    107501789 (PLA2G2E)
   04975 Fat digestion and absorption
    107501789 (PLA2G2E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107501789 (PLA2G2E)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107501789 (PLA2G2E)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107501789 (PLA2G2E)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 107501789
NCBI-ProteinID: XP_015983743
LinkDB
Position
Unknown
AA seq 142 aa
MKLPPLLTFLCLLVALAWGNLVQFGVMIEKMTGKPALQYNDYGCYCGIGGSHWPVDQTDW
CCHAHDCCYERLGKLGCEPKLERYLFSVGRSDIFCDGKTAFQKQTCECDRTAALCFRRNL
ATYNDSYAHYPNKLCSGPTPPC
NT seq 429 nt   +upstreamnt  +downstreamnt
atgaagcttccccctcttctgaccttcctctgcctcctggtggccctggcttgggggaac
ctggtccagtttggggtgatgatcgagaagatgacgggtaagccggccctgcagtacaac
gactatggctgctactgtggcatcggtggctcccactggccggtggaccagacggactgg
tgctgtcatgcccatgactgctgctatgagcgtctcgggaagctgggctgtgaacccaaa
ctggaaaggtatcttttctctgtcggcaggagcgacatcttctgtgacggcaaaactgcc
ttccagaaacagacctgcgagtgcgacaggaccgccgcactctgctttcgccgaaacctg
gccacctacaacgacagttacgcccattaccccaacaagctgtgctcagggcccaccccg
ccctgctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501790
Entry
107501790         CDS       T06036                                 

Gene name
PLA2G2A
Definition
(RefSeq) phospholipase A2, membrane associated
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04270  Vascular smooth muscle contraction
ray04972  Pancreatic secretion
ray04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107501790 (PLA2G2A)
   00565 Ether lipid metabolism
    107501790 (PLA2G2A)
   00590 Arachidonic acid metabolism
    107501790 (PLA2G2A)
   00591 Linoleic acid metabolism
    107501790 (PLA2G2A)
   00592 alpha-Linolenic acid metabolism
    107501790 (PLA2G2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107501790 (PLA2G2A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107501790 (PLA2G2A)
  09154 Digestive system
   04972 Pancreatic secretion
    107501790 (PLA2G2A)
   04975 Fat digestion and absorption
    107501790 (PLA2G2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107501790 (PLA2G2A)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107501790 (PLA2G2A)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107501790 (PLA2G2A)
SSDB
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_2
Other DBs
NCBI-GeneID: 107501790
NCBI-ProteinID: XP_015983744
LinkDB
Position
Unknown
AA seq 106 aa
MKTLLLLAVTTALGDLLPAPLQTHGDLVNFWKMIQLVTGKEPLFSYAFYGCYCGLGGKGS
PKDATDRCCATHDCCYGQLEKQECGTKFLSYEYTYKNGQILCAPPH
NT seq 321 nt   +upstreamnt  +downstreamnt
atgaagaccctcctgctgttggctgtgaccacggccctcggtgaccttcttccagcccca
ctgcagacccatggggacttggtgaatttctggaaaatgatccagttggtgacaggaaaa
gaacctttgttcagttatgccttctacggttgctactgcggcttaggcggcaaagggtca
cccaaggatgcgacagatcggtgctgtgctacccacgactgttgctacggccagctggag
aagcaagagtgtggcaccaagtttctgagctacgagtatacttacaagaatggccagatc
ctctgtgctcctccccactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501847
Entry
107501847         CDS       T06036                                 

Gene name
PLA2G2C
Definition
(RefSeq) putative inactive group IIC secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04270  Vascular smooth muscle contraction
ray04972  Pancreatic secretion
ray04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107501847 (PLA2G2C)
   00565 Ether lipid metabolism
    107501847 (PLA2G2C)
   00590 Arachidonic acid metabolism
    107501847 (PLA2G2C)
   00591 Linoleic acid metabolism
    107501847 (PLA2G2C)
   00592 alpha-Linolenic acid metabolism
    107501847 (PLA2G2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107501847 (PLA2G2C)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107501847 (PLA2G2C)
  09154 Digestive system
   04972 Pancreatic secretion
    107501847 (PLA2G2C)
   04975 Fat digestion and absorption
    107501847 (PLA2G2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107501847 (PLA2G2C)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107501847 (PLA2G2C)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107501847 (PLA2G2C)
SSDB
Motif
Pfam: Phospholip_A2_1 Parvo_coat_N Phospholip_A2_2
Other DBs
NCBI-GeneID: 107501847
NCBI-ProteinID: XP_015983897
LinkDB
Position
Unknown
AA seq 152 aa
MKVIGVLAVFASCLLAPTHSGFWQFQRMVKHITGRSAFFSYYGYGCYCGLGGKGTPVDDT
DRCCLAHDCCYEKLKQLGCQPVLSSYQFRIVNGTVACECTLGLGVGCLCGLRACECDKQS
AYCFKESLPTYEKNFKQFFSARPRCGRRKLQC
NT seq 459 nt   +upstreamnt  +downstreamnt
atgaaggtcattggcgtcctcgcggtcttcgcctcctgcctgctggcccccactcacagc
ggcttctggcagtttcagaggatggtcaaacacatcaccgggcggagcgccttcttctcc
tattacggatatggctgctactgtgggctggggggcaaagggacgcctgtggatgacacc
gacagatgctgcctggcacatgactgctgctatgagaagctgaagcagctcggctgtcag
cccgtgttgagcagctaccagttccgcatcgtcaatggcaccgtggcctgtgaatgtacc
cttggtctcggtgtcggctgcctctgcgggctgagggcctgcgaatgtgacaagcaatct
gcatactgtttcaaagagagcctgcccacctacgagaaaaacttcaagcagttcttctcc
gcccggccccggtgtggcagacgtaaactccagtgctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501853
Entry
107501853         CDS       T06036                                 

Gene name
PLA2G5
Definition
(RefSeq) calcium-dependent phospholipase A2 isoform X1
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04270  Vascular smooth muscle contraction
ray04972  Pancreatic secretion
ray04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107501853 (PLA2G5)
   00565 Ether lipid metabolism
    107501853 (PLA2G5)
   00590 Arachidonic acid metabolism
    107501853 (PLA2G5)
   00591 Linoleic acid metabolism
    107501853 (PLA2G5)
   00592 alpha-Linolenic acid metabolism
    107501853 (PLA2G5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107501853 (PLA2G5)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107501853 (PLA2G5)
  09154 Digestive system
   04972 Pancreatic secretion
    107501853 (PLA2G5)
   04975 Fat digestion and absorption
    107501853 (PLA2G5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107501853 (PLA2G5)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107501853 (PLA2G5)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107501853 (PLA2G5)
SSDB
Motif
Pfam: Phospholip_A2_1 Phospholip_A2_2 Parvo_coat_N
Other DBs
NCBI-GeneID: 107501853
NCBI-ProteinID: XP_015983909
LinkDB
Position
Unknown
AA seq 146 aa
MLRNWACRRHALVSPGAVGCLSGVHTVPGSLLNLMWMIEEVTGKNALINYAFYGCYCGWG
GHGTPKDATDWCCWEHDRCYGRMEDNGCKYWTIYKHRVTRGLVTCERGSRCQMGLCNCDR
KLVYCLKKNLRSYNNRYRHFPSFCCT
NT seq 441 nt   +upstreamnt  +downstreamnt
atgctgagaaattgggcctgtagaaggcacgccttggtttcacctggggctgtgggctgt
ctttcaggtgtgcatactgtgccagggagcttactaaacctgatgtggatgatcgaagag
gtgacaggaaagaatgccctgataaactacgccttctatggctgttactgtggttgggga
ggtcacgggacccccaaagacgctacagattggtgctgctgggaacatgaccgctgctat
gggcggatggaggataatggctgcaaatactggactatatacaaacacagagtcacacgg
ggcctggtcacctgtgagcgcgggtcccgctgccagatggggctctgcaactgtgaccgg
aagctggtctactgccttaagaaaaacctaaggagctacaacaaccgctaccgacacttt
cccagcttctgctgcacctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502506
Entry
107502506         CDS       T06036                                 

Gene name
PLA2G10
Definition
(RefSeq) group 10 secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04270  Vascular smooth muscle contraction
ray04972  Pancreatic secretion
ray04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107502506 (PLA2G10)
   00565 Ether lipid metabolism
    107502506 (PLA2G10)
   00590 Arachidonic acid metabolism
    107502506 (PLA2G10)
   00591 Linoleic acid metabolism
    107502506 (PLA2G10)
   00592 alpha-Linolenic acid metabolism
    107502506 (PLA2G10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107502506 (PLA2G10)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107502506 (PLA2G10)
  09154 Digestive system
   04972 Pancreatic secretion
    107502506 (PLA2G10)
   04975 Fat digestion and absorption
    107502506 (PLA2G10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107502506 (PLA2G10)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107502506 (PLA2G10)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107502506 (PLA2G10)
SSDB
Motif
Pfam: Phospholip_A2_1
Other DBs
NCBI-GeneID: 107502506
NCBI-ProteinID: XP_015985273
LinkDB
Position
Unknown
AA seq 161 aa
MCPLPLTLPVMLPLLLLLLVPGLLSSAVSLKSHVHRRGLIELAEAIDCVGPRSPLAYVSY
GCYCGLGGHGQPLDAIDWCCHHHDCCYQHANEEAGCRTKVEPYFWKCVDQHIICGPAEDR
CQELLCKCDQEIAYCLAQTKYSLRYLFYPRFLCGQDSLKCD
NT seq 486 nt   +upstreamnt  +downstreamnt
atgtgtccactgcctctgaccctgccagtaatgctgccgctgctgctgctgctcctggtc
cccgggctcctgtccagcgcagtctccttgaagtcacatgtgcaccggcgtgggctcata
gaactggcagaggccatagactgtgttggcccccgcagccccttggcctatgttagctac
ggctgctattgtggcctgggtggccatggccaacccctggatgccattgactggtgctgt
catcatcacgactgctgctaccagcatgcgaatgaggaggctggctgcaggaccaaggtg
gagccctacttctggaagtgcgtcgatcagcacatcatatgcggaccggcagaggacaga
tgtcaagaactcttgtgcaagtgtgaccaggagatcgcttactgcttagcccaaactaaa
tacagtttaaggtacctcttctacccccgtttcttatgtgggcaagactcgctcaagtgc
gactga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508827
Entry
107508827         CDS       T06036                                 

Gene name
PLA2G12A
Definition
(RefSeq) group XIIA secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04270  Vascular smooth muscle contraction
ray04972  Pancreatic secretion
ray04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107508827 (PLA2G12A)
   00565 Ether lipid metabolism
    107508827 (PLA2G12A)
   00590 Arachidonic acid metabolism
    107508827 (PLA2G12A)
   00591 Linoleic acid metabolism
    107508827 (PLA2G12A)
   00592 alpha-Linolenic acid metabolism
    107508827 (PLA2G12A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107508827 (PLA2G12A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107508827 (PLA2G12A)
  09154 Digestive system
   04972 Pancreatic secretion
    107508827 (PLA2G12A)
   04975 Fat digestion and absorption
    107508827 (PLA2G12A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107508827 (PLA2G12A)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107508827 (PLA2G12A)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107508827 (PLA2G12A)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 107508827
NCBI-ProteinID: XP_015996326
LinkDB
Position
Unknown
AA seq 189 aa
MALLPRPALALLLLVLPAVLRCQEQDQPTDWRATLKTIRNGVHKIDTYLNAALDLLGGED
GLCQYKCSDGSKPFPRYGYKPSPPNGCGSPLFGVHLNIGIPSLTKCCNHHDRCYETCGKS
KNDCDEEFQSCLSKICRDVQKTLGLAQHVQACETTVELLFDSVIHLGCKPYLDSQRAACR
CRYEEKTDL
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgctcccgcggccggcgctcgctctcctcctcctggtcctgcccgccgtgctc
aggtgccaggagcaggaccagcccaccgactggagggccaccctgaagaccatccggaac
ggcgttcacaagatcgacacgtacctgaacgccgccttggacctcctgggaggcgaggac
gggctctgccagtataagtgcagcgacggatctaagcctttcccacgttatggttataaa
ccctccccgccgaatggatgtggctctccactgtttggtgttcatcttaacattggcatc
ccttccctgacaaagtgctgcaaccaccacgacagatgctatgagacctgcggcaaaagc
aagaatgactgtgatgaggagttccagtcctgcctctccaagatctgccgagacgtgcag
aaaacactcggactcgctcagcacgttcaggcatgtgaaacaacagtggagctgttgttc
gacagcgttatacatttaggctgcaaaccatacctggacagccaacgggctgcatgtaga
tgtcgctacgaagaaaaaactgatctttaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510914
Entry
107510914         CDS       T06036                                 

Gene name
PLA2G4E
Definition
(RefSeq) LOW QUALITY PROTEIN: cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04217  Necroptosis
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04611  Platelet activation
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107510914 (PLA2G4E)
   00565 Ether lipid metabolism
    107510914 (PLA2G4E)
   00590 Arachidonic acid metabolism
    107510914 (PLA2G4E)
   00591 Linoleic acid metabolism
    107510914 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    107510914 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107510914 (PLA2G4E)
   04014 Ras signaling pathway
    107510914 (PLA2G4E)
   04370 VEGF signaling pathway
    107510914 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    107510914 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107510914 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107510914 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    107510914 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    107510914 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107510914 (PLA2G4E)
   04913 Ovarian steroidogenesis
    107510914 (PLA2G4E)
   04921 Oxytocin signaling pathway
    107510914 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107510914 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    107510914 (PLA2G4E)
   04726 Serotonergic synapse
    107510914 (PLA2G4E)
   04730 Long-term depression
    107510914 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107510914 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107510914 (PLA2G4E)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107510914 (PLA2G4E)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107510914
NCBI-ProteinID: XP_016000354
LinkDB
Position
Unknown
AA seq 887 aa
MLRSSPSSSQPVWSPGEMDVAGMTLQAPEGHAGLGADVFAPQSLQGDGEDSRSGRNVSEF
EHAQDLEASNHLPLLPTAPWGSQKELSPCHLLTVTVIRMKNVRQADRVTQTDCYVSLWLP
TASRERVRTRTISNCPNPEWNESFNFQIQRQVKNVLELSICDEDAVIPDDHLLTVLYDLT
KLGCRRKTHVKFPLNPEAMEELEVEFLLEESPCPPETLITNGVLVARQVSSLEVHAESRR
QRKRGKRRDLLVTVTESFEHTQHISQHLEPSCQKPACFHYPKYFQSQMHVDLPRSQWSCG
LCFSGVHKKSSPVCQPLDCLSDSQTVTLPAGENCELHVKSTPCPKTLDVRLGYSLCQEEL
EFLQKRKVVVAEALKQVLQLEEDLQMDEVPLIAIMSTGGGTRSMTAMYGHLLGLQKLNLL
NCASYITGISGATWTMANLYRDPDWSSKNLESAILEARRHVVKDKMPILYPDQLFRYQEE
LQQRSKEGYKVNFTDFWGLLIEACLGDERNECKLSEQRAALSQGQNPLPIYLTINVKDDV
SNQDFREWCEFSPYEVGMQKYGAFVPTELFGSEFFMGRLMKRIPESRMCYMLGLWSSIFS
VNLLDVWNFCSTSDEFFHRWTREKVQDIEDEPLLPEIPICDANVLDTSVVVPASWLSNTF
RHILTHRSFVSEFHNFLLGLQLHTNYLQNGQFSMWKDTVLDGFPNQLTGSVNHLSLLDTA
FFVNSSYPPLLRPERKPDLIIHLNYCAGSQTKPMKQTCEYCTEKNIPFPKYDLQEEENDN
LKECYLLENSQEPDAPIVLFFPLINDTFQKYKAPGVERSPEEMEKGQVDIYGPKTPYSTK
ELTYTEAAFDKMVNLCEYNILNNKDQLLQALRMAVEKKKLWKSRCPS
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgctaagaagcagtcccagctcctcacaacctgtctggagccccggagagatggatgtg
gctgggatgacgctccaggccccggaaggccatgctggcctgggagctgatgtgtttgcc
ccacagagcctacaaggggatggagaagatagcagatcaggaagaaatgtcagtgagttt
gagcacgcacaggacctggaagcttccaatcacctacctctccttcccacggccccgtgg
ggctctcagaaggagctatctccatgccacttgctaacagtgacggtcatcaggatgaaa
aatgtccggcaggctgatagggtgacccagacagactgctatgtgagcctctggctgcct
actgcctctcgcgagagggtgaggacgaggaccatctccaactgcccaaacccagaatgg
aatgaaagcttcaacttccagatccagaggcaagtgaagaacgtgctagagcttagcatc
tgtgatgaagacgcagtaataccagatgaccatcttttgacagttctctatgacctaacc
aagctcggctgccggaggaaaacccatgtgaagttcccacttaacccagaggccatggag
gagctggaggtagagtttctgctggaggaaagtccctgtccacctgagaccctcatcacc
aatggcgtgctggtggctcgacaagtctcttccctagaggttcatgcagaatccagaagg
cagaggaagagagggaaacggagggacctcctagtgacagtgacagagtccttcgagcac
acgcagcacatctcccaacacctggagcccagctgccaaaaacctgcctgctttcactac
cccaagtacttccagtcccagatgcatgtggacctgccccggagccagtggagctgtggg
ctttgcttctctggtgtgcacaagaagagcagccctgtctgccagcccctcgattgcctc
tcggacagccagacggtgaccctgcctgcgggagagaactgtgaattacacgtgaagtct
acaccctgccccaagacactggatgtgcgactgggctacagcctgtgccaggaggaactg
gagtttctacagaagcgaaaggtggtggtggctgaagcactgaagcaggtgttgcagctg
gaggaggacctgcagatggacgaggtaccgctcatagccatcatgtctactgggggtgga
acaagatccatgactgccatgtatgggcacctgctggggctgcagaagctgaacctcctg
aattgtgccagctacatcactggcatatcaggggctacctggaccatggctaatttgtac
cgtgaccctgactggtcctccaaaaacctggagtctgccatcctcgaggcccggaggcat
gtggtcaaggacaagatgcccatcctgtacccagaccagctgttcagataccaggaggag
ctccagcagcgcagcaaggaaggctacaaggtcaactttacagacttctggggcctgctg
attgaggcctgtctgggggacgagagaaatgaatgcaaactgtcagagcagcgtgctgct
ttgagccagggccagaaccccctgcccatctatctcaccatcaatgtcaaggatgatgta
agcaaccaggatttcagagagtggtgtgagttttccccctacgaggtaggcatgcagaag
tatggagccttcgtccccaccgagctcttcggctctgagttcttcatggggcggctgatg
aagaggataccagagtctcggatgtgctacatgcttggattgtggagcagcatcttttcc
gtgaacctgctcgatgtttggaatttttgtagcacttcagacgagtttttccacaggtgg
acgagagagaaggtgcaagacatcgaagatgagcctctccttcctgaaatccccatatgt
gatgccaacgtcctggacacttcggtggtggtcccagcgtcgtggctgtctaataccttc
cgccacatcctcacccatcggtcctttgtgtctgagttccacaacttcctactggggttg
cagctgcacaccaactacctccagaatggccagttctccatgtggaaagacactgtgctt
gacggcttcccgaaccagctgacagggtccgtgaaccacttgagtctactggacacagca
ttcttcgtcaactctagctacccaccactcctcaggcctgagagaaaacccgacctcatc
attcatctcaattattgtgcggggtcccagacaaagcctatgaaacaaacctgtgagtac
tgcaccgagaagaatatccccttccccaaatatgacctgcaagaggaagagaatgataat
ctcaaggaatgctacctgttggaaaactcccaagaacctgatgctcccatcgtgcttttc
ttcccactcatcaatgacaccttccaaaagtacaaggctccaggtgtggaacgaagccct
gaggagatggagaagggccaggttgacatttatggccccaaaactccctattccaccaag
gagctgacgtacacagaagccgcctttgacaaaatggtgaatctctgtgagtacaacatc
ctgaataacaaggaccagctccttcaggccttgcgaatggcagtggagaagaagaaactc
tggaagagccggtgtccctcctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510922
Entry
107510922         CDS       T06036                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytosolic phospholipase A2 beta-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04217  Necroptosis
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04611  Platelet activation
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107510922
   00565 Ether lipid metabolism
    107510922
   00590 Arachidonic acid metabolism
    107510922
   00591 Linoleic acid metabolism
    107510922
   00592 alpha-Linolenic acid metabolism
    107510922
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107510922
   04014 Ras signaling pathway
    107510922
   04370 VEGF signaling pathway
    107510922
   04072 Phospholipase D signaling pathway
    107510922
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107510922
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107510922
   04664 Fc epsilon RI signaling pathway
    107510922
   04666 Fc gamma R-mediated phagocytosis
    107510922
  09152 Endocrine system
   04912 GnRH signaling pathway
    107510922
   04913 Ovarian steroidogenesis
    107510922
   04921 Oxytocin signaling pathway
    107510922
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107510922
  09156 Nervous system
   04724 Glutamatergic synapse
    107510922
   04726 Serotonergic synapse
    107510922
   04730 Long-term depression
    107510922
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107510922
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107510922
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107510922
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107510922
NCBI-ProteinID: XP_016000378
LinkDB
Position
Unknown
AA seq 784 aa
MALAKVPGTCLLTXRVLQARGLPSKDLVTPSDCYVTLWLPTASSDRLRTRTVRNSRNPIW
NQSFRFQIHSQVKNVLQLQVFDQDLLTSDDPVLSVLFDVGTLRVGEFRSESFTLNPQGEE
KLEVEFRLQNLTDRAEQLFSNGILVARELSCLRVRLEEAGDQQGSKGKVHLVVPGSCEGP
QEATVGAGSLHFHCPACWEPELSVRLQDASQEQLKVPLRALPSRQVVRLVFPMSQEPLMR
VELKKEEGPKELAVRLGCEPCAEEQAFLSRRKQVVAKALKQALKLDGDLQEDEIPVVAVM
ATGGGVRAMTSLYGQLAGLRELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPIE
LLKTQVTKSKLGVLAPSQLQRYRQEMAERAHLGYPTCFTNLWALINEALLHDEPSDHKLS
DQRKALSHGQNPLPIYCALNTKEKNMTTFEFGEWCEFSPYEVGFPKYGAFIPPELFGSEF
YMGRLTKQLPESRICFLEGIWSNLYAASLQDSLYWSSEPSQFWDRWAQDQVSLDKEQTPL
LKIEETPTTACRIAEFFTDLLTRRPLAQATHNFMRGLHFHKDYFQHPHFAAWKATKLDGF
PNQLTPAESHLCLLDVGYLINTSCMPLLRPTRDVDLILSLDYNLHGAFQQLQLLGRFCGE
QRIPFPPISLSPEEQRQPQECHLFLHPDCPEAPAVLHFPLVNDSFREHSAPGVPRTAEEK
EAGEVNLSSSSSPYHYSKVTYSQEDVDKLLRLTHYNICNNREQLLEALREAVLRRRQRRQ
LQPQ
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggctctggcaaaggtgcctgggacctgcctgctcacgnttcgtgtcctgcaggcccgt
ggcctgccctccaaggacttagtgaccccctctgactgttatgtgactctgtggctgccc
acggcctccagcgacaggctccggacacgcacagttagaaacagcagaaaccccatctgg
aatcagagctttcgcttccaaatccacagccaggtcaagaatgtcctacaactgcaagtg
tttgaccaggaccttttgaccagtgatgaccccgtgttgtcggtgctgtttgatgtaggg
actttgagagttggggagttccgcagtgagagcttcaccctaaaccctcagggtgaggag
aagctggaagttgaatttcggctgcagaatctaacagaccgtgctgagcagctcttcagc
aatggcatcctggtggcccgggagctttcctgcttgcgtgttcgactggaagaggcaggg
gaccagcagggttcaaaaggcaaagttcaccttgtggtccctgggtcctgtgagggtcct
caggaagccacagtgggcgctggctccttgcacttccactgcccagcctgctgggagccg
gagctgagtgttcgtttgcaggatgcctcccaggagcaactgaaggtacccctgagggct
ctgccctctcgtcaagtggttaggctcgtcttccctatgtcccaggagcccctgatgagg
gtggagctgaaaaaagaagaaggaccgaaggagctggccgtgcggctgggctgcgagccc
tgtgcagaggagcaggccttcctgagcaggaggaagcaggtggtggccaaggccctgaag
caggccctgaagctggatggagacctgcaggaggacgagatcccagtagtagctgttatg
gccactggtggtggggtccgtgcgatgacttctctgtatgggcagctggctggcctgagg
gagctgggcctcttggattgtgtttcctacatcacaggggcctcaggctccacttgggct
ttggccaacctctatgaagacccagagtggtctcagaaggacctggcagggcccattgag
ttgctgaagacccaggtgaccaagagcaagctaggcgtgttggcccccagccagctgcaa
agataccggcaggagatggccgagcgtgcccacctgggctacccaacctgtttcactaac
ctgtgggccctcatcaatgaggcgctgctgcatgatgagcccagtgaccacaaactctca
gaccagcggaaggccctgagtcatggccagaaccctctgcccatctactgtgccctcaac
accaaggaaaagaacatgaccacctttgagtttggggagtggtgtgagttctccccctat
gaggttggctttcccaagtatggcgccttcatcccccccgagctctttggctctgagttc
tacatgggacgcctgacaaagcaacttcctgagtcccgcatctgcttcctggaaggtatc
tggagcaacctgtatgcagccagcctccaagacagtttatactggtcctcagagcccagc
cagttctgggaccgctgggcgcaggatcaggtcagcctggacaaggagcagacccctctt
ttgaagatagaagaaactcccacaacagcatgcaggatagctgagtttttcactgacctt
ctgacgcggcgcccacttgcccaggccacccacaacttcatgcgtggccttcatttccac
aaggactatttccagcatcctcacttcgccgcctggaaagccaccaaactggatgggttc
cccaaccagctgacacctgcggagtcccacctttgcctgctagatgtcggctaccttatt
aacaccagctgcatgcctctcctgcggccaacacgggatgtggacctcatcctgtcactg
gattacaacctccacggagcctttcagcaactgcagctcctgggccggttctgcggggag
cagaggatcccgttcccacccatctcactgagccctgaggagcagcgccagcctcaggag
tgtcacctgttcttgcaccccgactgccctgaagcccctgctgtgctacacttccccctg
gtcaatgactccttccgggagcactcggcccctggggtcccacggacagctgaggagaag
gaagctggggaggtgaacctctcttcctccagctccccctaccactactcgaaggtgacc
tacagccaggaggatgtggacaagctgctccgcctgacacattacaacatctgcaacaac
cgggagcagctgctggaggccctgcgtgaggctgtgctgcggcggaggcagcgcaggcag
ctccagccccagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510924
Entry
107510924         CDS       T06036                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04217  Necroptosis
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04611  Platelet activation
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107510924 (PLA2G4F)
   00565 Ether lipid metabolism
    107510924 (PLA2G4F)
   00590 Arachidonic acid metabolism
    107510924 (PLA2G4F)
   00591 Linoleic acid metabolism
    107510924 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    107510924 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107510924 (PLA2G4F)
   04014 Ras signaling pathway
    107510924 (PLA2G4F)
   04370 VEGF signaling pathway
    107510924 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    107510924 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107510924 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107510924 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    107510924 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    107510924 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107510924 (PLA2G4F)
   04913 Ovarian steroidogenesis
    107510924 (PLA2G4F)
   04921 Oxytocin signaling pathway
    107510924 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107510924 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    107510924 (PLA2G4F)
   04726 Serotonergic synapse
    107510924 (PLA2G4F)
   04730 Long-term depression
    107510924 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107510924 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107510924 (PLA2G4F)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107510924 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107510924
NCBI-ProteinID: XP_016000382
LinkDB
Position
Unknown
AA seq 849 aa
MLWALWPRWLAGKGLPLLGVMLLRKRDKRGSQWSHWQRETHPYYDLQVKVLRARNIQGTD
LLSKADCYVQLWLPTASPSRAQTRMVANCSDPEWNETFHYQIHAAVKNVLELTLCDKDIL
GSKKLSVLLFDLESLKPGQPHRHTFPLNQQDSQELQVEFVLENSQVPASEVITNGVLVAH
PCLRIQGTLGGDATAPHQEYGSRQIRLVVPGAYEKPQLLPLQPPLEAEPPATFTFHVNPV
LHSRLDVELGENLMVLQSDPSAELEAQSSKLGEGGILLSSLALGQEEQRLVALGEGQEVT
LNVKAEMSSGDLDLRLGFDLCDGEQKFLDKRKQIVSKALQQVLKLNQAPDSDQVPVVAVL
GSGGGTRAMSSLYGSLTGLQELGLLDTVTYLKGVSGSTWCISTLYKDPAWSQVALQGPTE
LARGRVCSSKIGAVSTERLQYYAQELGKLESSGHSISLIDLWGLLIEYFLYQEENPAKLS
DQQEAISQGQNPYPIYASINVRTNISGEDFAEWCEFTPHEIGFPKYGAYIPTKLFGSEFF
MGRLLKLWPEPRICYLQGMWGSAFAASLDEIFMKTAGFSLSFLDLHRGHVNITDDCQKLQ
LHDPTRLRTKLFTRQGPFSQAVLDIFTSRFTAAENFNFTQGLCLHKDYVAGREFTAWKDT
HLDALPNELTPMRDCLYLVDGGFALNSPFPLSLLPQRAVDLIVSFDYSLDAPFEVLQMTE
KYCRDRGIPFPRVEVLPEDLEEPRECYLFDRAEDPCSPIVLHFPLVNRTFRTHLAPGVER
QTAEEKAHGDFAINGPDTPYGMTNFTYEPEEFDRLVALSRYNVLNNAETVRRALRLALDR
RQAGARAGG
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgctctgggcgttgtggcctaggtggctggcaggcaaggggctacccctcctgggggta
atgctgctgcggaagagagacaaaaggggatctcagtggagtcactggcagcgggaaacc
cacccatactatgacctccaggtgaaggtgctgagggccagaaatatccagggcacagat
ctgttgtccaaagctgactgctatgtgcaactgtggctgcccacggcatcccccagccgt
gcccagacaaggatggtggccaactgcagtgaccccgagtggaacgagactttccactac
cagatacatgctgctgtgaagaatgtcctggagctcaccctctgtgacaaggacatcctg
ggtagcaagaagctctctgtgctgctgtttgacctggagagcctcaagcctggccaaccc
cacagacacactttcccactcaaccaacaggattcacaagagctgcaggtggagtttgtt
ctggagaacagccaagtacctgcatctgaagtcatcaccaatggtgtcctggtggctcat
ccctgtctgagaatccagggcacccttgggggagatgcaacagcccctcatcaagaatat
ggttctaggcagattcggttggtagtgcccggggcctacgagaaaccacagctcttgcct
ctgcagcctcccttggaggcagaacccccagccacttttaccttccatgtgaatccagtg
ctacactccaggctggatgtcgagctgggagagaatctcatggtcctgcagagtgaccca
agtgctgagttggaggcccagagcagcaagctgggagaggggggcatcctgctctcttct
ctggccttaggccaggaggagcagcgcttggtggccctgggggagggccaggaggtaact
ctgaatgtgaaggcagaaatgagctctggagaccttgacctgcgccttggctttgacctc
tgtgatggagaacagaagtttctggacaagaggaagcagatcgtgtctaaggctttgcag
caggtgctgaaactgaaccaggctcctgacagtgaccaggtacctgtggtggctgtgctg
ggttcgggaggcggaacccgtgctatgtcttccctgtatggcagcctgacagggctgcag
gagcttggcctcttggacactgtgacctacttgaaaggggtttctgggtccacctggtgc
atctccacactctacaaagacccagcctggtcccaggtggctttgcagggccccactgag
cttgcccggggtcgggtctgcagcagtaagataggggcggtatccacggaacgtctacaa
tactatgcccaggaactggggaaactggaaagcagtggtcacagcatttccctcatcgac
ctctggggcctcctcattgaatatttcctataccaagaggaaaaccctgccaaactgtct
gaccaacaggaggcaatcagccagggccagaacccttatcccatctatgccagcatcaat
gtccgtaccaacatcagtggggaagactttgcagagtggtgtgagttcaccccccacgag
atcggcttccccaagtatggggcttatattcccaccaagctctttggctcagagttcttc
atggggcgactgctgaagctctggccagagccccggatctgctacttgcagggtatgtgg
ggcagtgcctttgcagccagcctggatgagattttcatgaagactgctggcttcagcctc
agcttcctggacttgcaccgaggccatgtaaacatcacagatgactgccagaagctccag
ttgcatgaccccaccaggctgcgaacaaagctcttcactcggcaggggcccttctcccag
gctgtgctggacatattcacgtcccgctttaccgccgcggagaacttcaacttcacccag
ggcctctgcctgcacaaggactatgtggctggcagggagttcacggcctggaaagacact
cacctggacgccttgcccaatgagctcactcctatgagggactgcctgtacctggtggac
gggggctttgctctcaactccccattcccactgagcctgctgccgcagagagcagtggac
ctcattgtgtcctttgactactccctggatgccccttttgaggtcttacagatgacagag
aagtactgccgggaccgaggcatcccctttcccagggtcgaggtgctccctgaggacctg
gaggaaccccgtgagtgctacctgtttgacagagctgaggacccttgctcacccatcgtg
ctgcacttccctcttgtcaaccgtaccttccgcacacacctggccccaggtgtggagcga
caaacagccgaggagaaggcccatggagactttgccatcaacgggccagacacgccctat
ggcatgacgaacttcacctatgagcccgaggagttcgatcggctggtggccctgagtcga
tacaacgttctgaacaacgcggagactgtgaggcgtgccctccggctggctctggaccgg
cggcaggctggagccagggctggaggctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510925
Entry
107510925         CDS       T06036                                 

Gene name
PLA2G4D
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04217  Necroptosis
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04611  Platelet activation
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107510925 (PLA2G4D)
   00565 Ether lipid metabolism
    107510925 (PLA2G4D)
   00590 Arachidonic acid metabolism
    107510925 (PLA2G4D)
   00591 Linoleic acid metabolism
    107510925 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    107510925 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107510925 (PLA2G4D)
   04014 Ras signaling pathway
    107510925 (PLA2G4D)
   04370 VEGF signaling pathway
    107510925 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    107510925 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107510925 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107510925 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    107510925 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    107510925 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107510925 (PLA2G4D)
   04913 Ovarian steroidogenesis
    107510925 (PLA2G4D)
   04921 Oxytocin signaling pathway
    107510925 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107510925 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    107510925 (PLA2G4D)
   04726 Serotonergic synapse
    107510925 (PLA2G4D)
   04730 Long-term depression
    107510925 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107510925 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107510925 (PLA2G4D)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107510925 (PLA2G4D)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107510925
NCBI-ProteinID: XP_016000383
LinkDB
Position
Unknown
AA seq 825 aa
MERLTSRGPPGHPHQGVASVCWWLTVRVLEARGLGWADMLSEADPYVVLQLSTAPGIKFK
TKTVTNSSHPVWNETFSFLIQSQVKNVLQLSVYDEDSVTEDDVCFQFLYDVSEVLPGKLL
RKTFSLSPQRQEELDVEFLMEKTSDRPENLITNNVLVARELSCLDVRLKNTGSTAVVASE
TRSEPDQDKLELELELVLKGSYEDTQTSALSTASAFRFHYMEAQEAELSGHLRSSKSNDW
NSASSAGHLTVPLRSLVVGKEMTMDIPATNAPGVRLQLKTEGCQKEPAVRLGFDLCAEEQ
AFLSRRKQVVAKALKQALQLDGDLQEDEVPVVGIMATGGGARAMTSLYGHLLALKKLGLL
DCVTYFSGISGATWTMAQLYADPEWSQRDLERPIQYAREHLTKSKLETFSPERLANYRRE
LELRAEQGHPTTFVDLWALVLESMQHGQVMDQKLSGQRAALEQGQNPLPLYLSLNVKENN
LKTFDFKEWVEFSPYEVGFLKYGAFVPSELFGSEFFMGRLMRRIPESRICFLEGIWSNIF
SLNLLEAWYDLTSSDDDQKQRIKDKIRKLEKPPASSKTSSWLEALWLQPGTALAQAFKGF
LTNRPLYQHSSNFLQGLQLHQDYCDQKDFSTWADSQLDSIPGQLTPQEPHLCLVDAGHFL
NTSCPSMLRPSRRLDLILSFDYSQKPFEVLQQTKLYCQGLGLPFPHLEPSLQEQCQPKEC
HLFSDPTCPDAPVLLHFPLVNVSFKDYSAPGVQRSPAELPDGQVDLNPDTSPYSLFSTTY
KEEDFDRLLQLSDYNVQNSQGTILQALRMALKRRAPGARLPGAQT
NT seq 2478 nt   +upstreamnt  +downstreamnt
atggagagactgacatctaggggaccacctggccatcctcatcagggggtggcctctgtc
tgctggtggctcacggtgagggtcctggaagctcgaggcctgggctgggctgacatgttg
agcgaggcagacccttacgtggtcctacagctgtcaactgcacctggaattaagtttaag
accaaaactgtcaccaactccagtcatcctgtatggaatgagaccttcagtttcctaatc
cagagtcaggtcaagaatgttctgcaactgagcgtctatgatgaggattcagtcacggag
gatgatgtctgtttccagtttctctatgacgtctcagaagtcctgcctggcaaacttctc
cggaagaccttctccctgagtccccagagacaagaggaactggatgtggagttcctgatg
gaaaaaacgtctgaccgcccagaaaacctcatcaccaacaacgtccttgtggcgcgggag
ctgtcatgcctagatgtccgtctgaagaacacggggagcacagccgtggtagcaagtgag
acccgctcagaaccagatcaggacaagctggagctggagttggagctggtgctaaagggg
tcatatgaggacacacagacatctgctctgagcacagcctctgccttccgctttcactac
atggaggctcaagaggcagagctgagtgggcatctgaggagctccaaaagcaatgactgg
aactcagctagctcagctggacacctcactgtgcccctgaggtccttggttgtggggaag
gagatgaccatggacattcctgctacgaatgccccaggagtgaggctgcagctcaagact
gagggctgccagaaggagccggctgttcgcctgggctttgatctgtgtgcagaggagcag
gccttcctgagcaggaggaagcaggtggtggccaaggccctgaagcaggccctgcagctg
gacggagacctgcaggaagatgaggtccccgtcgtgggcatcatggccacaggaggaggt
gcccgggccatgacttctctctatggccatctgttggccctgaaaaagctgggactcctg
gactgcgtgacctatttcagtggcatctcgggagctacatggacaatggcccaactatat
gcggatcctgagtggtcacagagggacctcgagagacccatccagtatgcccgggaacac
ctcaccaagagcaagctggagaccttctccccagaacgtctggcaaactaccgcagggag
ctggagctgcgggcggagcaaggccacccgacgaccttcgtggacctgtgggctctggtg
ctggagtccatgcagcacggtcaggtgatggatcagaagctttcaggacagagagctgca
ctggagcagggccagaaccctctgcccctctacttgagcctcaatgtcaaagagaacaat
ctgaagactttcgacttcaaggagtgggttgagttctccccttatgaggtcgggttcctg
aagtatggagcctttgtcccttctgagctctttggctccgagttcttcatggggcggctg
atgaggaggatcccagagtcccggatctgctttctagaaggtatctggagcaacattttc
tccctgaacttgctggaagcctggtatgatctcaccagctctgatgatgaccagaagcaa
cgcatcaaggacaagatcaggaaactagagaagccccctgcctcctcaaagacttcctca
tggctggaggccttgtggctgcagcctggaaccgcactggcccaggcatttaagggcttc
ctgacaaaccggccactctaccagcatagctccaacttcctccagggcctccagctgcat
caggactactgcgaccagaaagatttctctacctgggcagacagccagctagactccatc
cctggccagctgaccccgcaggagcctcatctctgcctggtggatgctggccactttctc
aacaccagctgtccctccatgctccgaccaagccgcaggctggatctcatactctccttc
gactactctcagaagccttttgaggtgctgcagcagaccaagctgtactgccagggcctg
ggactgcctttcccccacttggagcccagcctgcaggaacaatgccagcccaaggagtgc
cacctcttctcagacccgacctgcccagatgctcctgtcctattgcatttcccactggtc
aatgtctccttcaaggactactcagcacctggtgtccagcgcagccctgcagagctccca
gacggccaggtggatctgaatccggacacctcaccctattccctgttcagcacgacctac
aaggaggaagactttgaccgcttgctgcaactcagtgattacaatgtccagaatagccag
ggcaccatcctgcaggccttgagaatggctctgaagcgccgggccccgggggccaggctt
ccaggggcacaaacttga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107514503
Entry
107514503         CDS       T06036                                 

Definition
(RefSeq) cytosolic phospholipase A2 beta-like isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04217  Necroptosis
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04611  Platelet activation
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107514503
   00565 Ether lipid metabolism
    107514503
   00590 Arachidonic acid metabolism
    107514503
   00591 Linoleic acid metabolism
    107514503
   00592 alpha-Linolenic acid metabolism
    107514503
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107514503
   04014 Ras signaling pathway
    107514503
   04370 VEGF signaling pathway
    107514503
   04072 Phospholipase D signaling pathway
    107514503
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107514503
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107514503
   04664 Fc epsilon RI signaling pathway
    107514503
   04666 Fc gamma R-mediated phagocytosis
    107514503
  09152 Endocrine system
   04912 GnRH signaling pathway
    107514503
   04913 Ovarian steroidogenesis
    107514503
   04921 Oxytocin signaling pathway
    107514503
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107514503
  09156 Nervous system
   04724 Glutamatergic synapse
    107514503
   04726 Serotonergic synapse
    107514503
   04730 Long-term depression
    107514503
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107514503
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107514503
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107514503
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 107514503
NCBI-ProteinID: XP_016007770
LinkDB
Position
Unknown
AA seq 787 aa
MALVRQAKVPGTCLLTVRVLQARGLPSKDLVTPSDCYVTLWLPTASSDRLRTRTVRNSRN
PIWNQSFRFQIHSQVKNVLQLQVFDQDLLTSDDPVLSVLFDVGTLRVGEFRSESFTLNPQ
GEEKLEVEFRLQNLTDRAEQLFSNGILVARELSCLRVRLEEAGDQQGSKGKVHLVVPGSC
EGPQEATVGAGSLHFHCPACWEPELSVRLQDASQEQLKVPLRALPSRQVVKLVFPMSQEP
LMRVELKKEEGPKELAVRLGCEPCAEEQAFLSRRKQVVAKALKQALQLDGDLQEDEIPVV
AVMATGGGVRAMTSLYGQLAGLRKLGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAG
PIELLKTQVTKSKLGVLAPSQLQRYRQEMAERAHLGYPTCFTNLWALINEALLHDEPSDH
KLSDQRKALSHGQNPLPIYCALNTKEKNMTTFEFGEWCEFSPYEVGFPKYGAFIPPELFG
SEFYMGRLTKQLPESRICFLEGIWSNLYAASLQDSLYWSSEPSQFWDRWAQDQVSLDKEQ
VPLLKIEETPTTAGRIAEFFTDLLTRRPLAQATHNFMRGLHFHKDYFQHPHFAAWKATKL
DGFPNQLTPAESHLCLLDVGYLINTSCMPLLRPTRDVDLILSLDYNLHGAFQQLQLLGRF
CGEQRIPFPPISLSPEEQRQPQECHLFLHPDCPEAPAVLHFPLVNDSFREHSAPGVPRTA
EEKEAGEVNLSSSSSPYHYSKVTYSQEDVDKLLRLTHYNICNNREQLLEALREAVLRRRQ
RRQLQPQ
NT seq 2364 nt   +upstreamnt  +downstreamnt
atggctctggtaagacaggcaaaggtgcctgggacctgcctgctcaccgttcgtgtcctg
caggcccgtggcctgccctccaaggacttagtgaccccctctgactgttatgtgactctg
tggctgcccacggcctccagcgacaggctccggacacgcacagttagaaacagcagaaac
cccatctggaatcagagctttcgcttccaaatccacagccaggtcaagaatgtcctacaa
ctgcaagtgtttgaccaggaccttttgaccagtgatgaccccgtgttgtcggtgctgttt
gatgtagggactttgagagttggggagttccgcagtgagagcttcaccctaaaccctcag
ggtgaggagaagctggaagttgaatttcggctgcagaatctaacagaccgtgctgagcag
ctcttcagcaatggcatcctggtggcccgggagctttcctgcttgcgtgttcgactggaa
gaggcaggggaccagcagggttcaaaaggcaaagttcaccttgtggtccctgggtcctgt
gagggtcctcaggaagccacagtgggcgctggctccttgcacttccactgcccagcctgc
tgggagccggagctgagtgttcgtttgcaggatgcctcccaggagcaactgaaggtaccc
ctgagggctctgccctctcgtcaagtggttaagctcgtcttccctatgtcccaggagccc
ctgatgagggtggagctgaaaaaagaagaaggaccgaaggagctggccgtgcggctgggc
tgcgagccctgtgcagaggagcaggccttcctgagcaggaggaagcaggtggtggccaag
gccctgaagcaggccctgcagctggatggagacctgcaggaggacgagatcccagtagta
gctgttatggccactggtggtggggtccgtgcgatgacttctctgtatgggcagctggct
ggcctgaggaagctgggcctcttggattgtgtttcctacatcacaggggcctcaggctcc
acttgggctttggccaacctctatgaagacccagagtggtctcagaaggacctggcaggg
cccattgagttgctgaagacccaggtgaccaagagcaagctaggcgtgttggcccccagc
cagctgcaaagataccggcaggagatggccgagcgtgcccacctgggctacccaacctgt
ttcactaacctgtgggccctcatcaatgaggcgctgctgcatgatgagcccagtgaccac
aaactctcagaccagcggaaggccctgagtcatggccagaaccctctgcccatctactgt
gccctcaacaccaaggaaaagaacatgaccacctttgagtttggggagtggtgtgagttc
tccccctatgaggttggctttcccaagtatggcgccttcatcccccccgagctctttggc
tctgagttctacatgggacgcctgacaaagcaacttcctgagtcccgcatctgcttcctg
gaaggtatctggagcaacctgtatgcagccagcctccaggacagtttatactggtcctca
gagcccagccagttctgggaccgctgggcgcaggatcaggtcagcctggacaaggagcag
gtccctcttttgaagatagaagaaactcccacaacagcaggcaggatagctgagtttttc
actgaccttctgacacggcgcccacttgctcaggccacccacaacttcatgcgtggcctt
catttccacaaggactatttccagcatcctcacttcgccgcctggaaagccaccaaactg
gatgggttccccaaccagctgacacctgcggagtcccacctttgcctgctagatgtcggc
taccttatcaacaccagctgcatgcctctcctgcggccaacacgggatgtggacctcatc
ctgtcactggattacaacctccacggagcctttcagcaactgcagctcctgggccggttc
tgcggggagcagaggatcccgttcccacccatctcactgagccctgaggagcagcgccag
cctcaggagtgtcacctgttcttgcaccccgactgccctgaagcccctgctgtgctacac
ttccccctggtcaatgactccttccgggagcactcggcccctggggtcccacggacagct
gaggagaaggaggctggggaggtgaacctctcttcctccagctccccctaccactactcg
aaggtgacctacagccaggaggatgtggacaagctgctccgcctgacacattacaacatc
tgcaacaaccgggagcagctgctggaggccctgcgtgaggctgtgctgcggcggaggcag
cgcaggcagctccagccccagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516857
Entry
107516857         CDS       T06036                                 

Gene name
PLA2G12B
Definition
(RefSeq) group XIIB secretory phospholipase A2-like protein isoform X1
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04270  Vascular smooth muscle contraction
ray04972  Pancreatic secretion
ray04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107516857 (PLA2G12B)
   00565 Ether lipid metabolism
    107516857 (PLA2G12B)
   00590 Arachidonic acid metabolism
    107516857 (PLA2G12B)
   00591 Linoleic acid metabolism
    107516857 (PLA2G12B)
   00592 alpha-Linolenic acid metabolism
    107516857 (PLA2G12B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107516857 (PLA2G12B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107516857 (PLA2G12B)
  09154 Digestive system
   04972 Pancreatic secretion
    107516857 (PLA2G12B)
   04975 Fat digestion and absorption
    107516857 (PLA2G12B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107516857 (PLA2G12B)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107516857 (PLA2G12B)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107516857 (PLA2G12B)
SSDB
Motif
Pfam: PLA2G12
Other DBs
NCBI-GeneID: 107516857
NCBI-ProteinID: XP_016012510
LinkDB
Position
Unknown
AA seq 195 aa
MKLTTSFLILWLSLGRGLAQSDTSPDAEETYSDWGLRHIRGSFESVNSYFDSFLELLGGK
NGVCQYRCRYGKAPMPRPGYKPQEPNGCSSYFLGLKVPESMDLGIPAMTKCCNQLDVCYD
TCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEVACDSLADTVFNTVWTLGCRPFMNS
QRAACICVEEDKEEL
NT seq 588 nt   +upstreamnt  +downstreamnt
atgaagctaaccaccagcttcttgattttgtggctcagcctcgggcgcggcctggcacag
agcgacaccagccctgacgcagaggagacctattcagactggggccttcggcacattcgg
ggcagcttcgaatctgtcaacagctactttgattcctttctggagctgctgggtgggaaa
aatggagtctgtcagtacaggtgccgatacggaaaggcacccatgcccagacctggctac
aagcctcaggagcccaatggctgcagctcctacttcctgggtctcaaggtaccggaaagt
atggacttgggcattccagcaatgaccaagtgctgcaaccagctggatgtctgctatgac
acttgtggtgccaacaagtatcgctgtgatgcaaaattccgatggtgcctccactctatc
tgctctgaccttaagcggagtctgggctttgtctccaatgtggaagtagcttgtgattct
ctggctgatactgtcttcaatactgtctggaccttgggctgccgaccctttatgaatagt
caacgggcagcctgcatctgtgtggaagaggacaaagaagaattatga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519256
Entry
107519256         CDS       T06036                                 

Gene name
PLA2G6
Definition
(RefSeq) 85/88 kDa calcium-independent phospholipase A2 isoform X1
  KO
K16343  calcium-independent phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04270  Vascular smooth muscle contraction
ray04666  Fc gamma R-mediated phagocytosis
ray04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107519256 (PLA2G6)
   00565 Ether lipid metabolism
    107519256 (PLA2G6)
   00590 Arachidonic acid metabolism
    107519256 (PLA2G6)
   00591 Linoleic acid metabolism
    107519256 (PLA2G6)
   00592 alpha-Linolenic acid metabolism
    107519256 (PLA2G6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107519256 (PLA2G6)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    107519256 (PLA2G6)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107519256 (PLA2G6)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107519256 (PLA2G6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ray03029]
    107519256 (PLA2G6)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107519256 (PLA2G6)
Mitochondrial biogenesis [BR:ray03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Other mitophagy factors
    107519256 (PLA2G6)
SSDB
Motif
Pfam: Ank_4 Ank_2 Ank Ank_5 Ank_3 Patatin
Other DBs
NCBI-GeneID: 107519256
NCBI-ProteinID: XP_016017233
LinkDB
Position
Unknown
AA seq 809 aa
MQFFGRLVNTLSSVTNMFSNPFRVKEVAVADYILSVRVQEEGQLILFQNTSNRTWDCILV
NPRNSQSGFRLFQLDTEADALVNFQYYSSQLPPFYESSSHILHTEVLQQLTDLIRSHPSW
SVAHLAVELGIRECFHHSRIISCANSTENEEGCTPLHLACRKGDGEILVELVQYCHAQMD
VTDNNGETAFHYAVQGDNSHVLQLLGKNASAGLNQMNNQGQTPLHLACQMGKQEMVRVLL
LCNARCNILGPGGYPIHTAMKFSQKGCAEMIISMDSNQIHSKDPRYGASPLHWAKNAEMA
RMLLKRGCDVNGTSSAGNTALHVAVMRERHDCVMVLLTYGANANARGEHGNTPLHLAMSK
DNVEIIKALIVFGAEVDTPNDFGESPAFIASKMSKLVTRKSLLTLLRTIGADCRFPLLQA
APTEPGCAPPPPVRHPFSLERSQPPPICLSDLELQDLMHISRARKPTFILSSMRDEKRSH
DHLLCLDGGGVKGLIIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYM
RGVYFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDIKKPKVMLTGTLSDRQPAELH
LFRNYDAPETVREPRFNQNINLKPLTQPSEQLVWRAARSSGAAPTYFRPNGRFLDGGLLA
NNPTLDAMTEIHEYNQDMIRKGQGNKVKKLSIVVSLGTGRSPQVPVTCVDVFRPSNPWEL
AKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGTDIMLDEVSDTV
LVNALWETEVYIYEHREQFQKLIQLLLSP
NT seq 2430 nt   +upstreamnt  +downstreamnt
atgcagttcttcggccgccttgtcaataccctcagtagcgtcaccaacatgttctctaac
ccgttccgggtgaaggaggtggctgtggccgactacatcttgagtgtccgggttcaggag
gaagggcagctgattctcttccagaacacttccaatcgcacctgggactgcatcctggtc
aaccccaggaactcacagagtggattccgactcttccagctggacacggaggccgatgcc
ctggtcaacttccagtactattcgtcccagttgccgcccttctacgagagctcctcccac
atcctgcacacggaggtcctgcagcagctgaccgacctcatccgcagccaccccagctgg
tcggtggcccacttggcggtggagttggggatccgagagtgcttccatcacagccgcatc
atcagctgcgccaacagcacggagaatgaggagggctgcacgcccctgcacctggcctgc
cgcaagggtgacggggagatcctggtagagctggtgcagtactgccatgcccagatggac
gtcaccgacaacaacggagagacggccttccattatgccgtccagggtgacaactcccac
gtgctgcagcttctagggaagaatgcgtctgccggcctgaaccagatgaacaaccagggg
cagaccccgctgcacctggcctgccagatggggaagcaggagatggtccgcgtgctgctg
ctgtgcaatgcccggtgcaacatcctggggcccggcggctaccccatccacacggccatg
aagttctcccagaaggggtgtgctgaaatgatcatcagcatggacagcaaccagatacac
agcaaagaccctcgctatggagccagccccctgcactgggccaagaacgcagagatggcc
cgcatgctgctgaaacgaggctgcgacgtgaacggcaccagctccgcggggaacacagcc
ctgcacgtggcagtgatgcgtgagcgccacgactgtgtcatggtgctgctgacctacggg
gccaacgcgaacgcgcgcggagagcacggcaacacgccgctgcacctggccatgtcgaaa
gacaatgtggagataatcaaggccctcattgtgttcggagcagaggtagacaccccgaat
gactttggggagagtcccgcattcatcgcctccaagatgagcaaacttgtcaccaggaag
tcactcttaactctgctgagaaccataggggctgactgccgcttcccactcctccaagca
gcccccacggagccgggctgcgcgccgccaccgccggtgcgtcaccccttctccctggaa
agatctcagcccccaccgatctgcctaagcgacctagagctgcaggacctaatgcacatc
tcccgggcccggaagccaaccttcatcctgagctccatgcgggacgagaagcggagccac
gaccacctgctctgcctggatggagggggcgtgaaaggcctgatcatcatccagctcctc
atcgccatcgagaaggcctcgggcgtcgctaccaaggacctctttgactgggtggcaggg
accagcactgggggcatcctggccctggccattttgcacagcaagtccatggcctacatg
cgtggcgtgtactttcgcatgaaggatgaggtgttccggggctcgcggccctacgagtcg
gggcccctggaggagttcctgaagcgagagtttggagagcacaccaagatgacggacatc
aagaagcccaaggtgatgctgacagggacactgtccgaccggcagccagctgagcttcac
ctcttccggaactacgatgctccggagactgtacgggagcctcgtttcaaccagaatatt
aacctaaagcctctaactcagccctcagagcagctggtgtggcgggcagcccggagcagc
ggggcagcccccacctacttccggcctaacgggcgtttcctggatggcgggctgctggcc
aacaaccccacgctggacgccatgaccgagatccatgagtacaaccaggacatgatccgc
aagggtcagggcaacaaggtgaagaaactctccatcgttgtctctctggggacagggagg
tccccgcaggtgcctgtgacctgcgtggatgtcttccgtcccagcaacccctgggaactg
gctaagactgtttttggggccaaggaactgggcaagatggtggtggactgttgcacagat
ccggatgggcgggccgtggaccgggcccgggcctggtgcgagatggtcggcatccagtac
ttcagattgaacccccagctggggacagacatcatgctggacgaagtcagtgacacggtg
ctggtcaacgccctttgggagaccgaggtctacatctacgagcaccgggagcagttccag
aagctcatccagctgctgctctcgccataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521019
Entry
107521019         CDS       T06036                                 

Gene name
PLA2G3
Definition
(RefSeq) group 3 secretory phospholipase A2
  KO
K01047  secretory phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04014  Ras signaling pathway
ray04270  Vascular smooth muscle contraction
ray04972  Pancreatic secretion
ray04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107521019 (PLA2G3)
   00565 Ether lipid metabolism
    107521019 (PLA2G3)
   00590 Arachidonic acid metabolism
    107521019 (PLA2G3)
   00591 Linoleic acid metabolism
    107521019 (PLA2G3)
   00592 alpha-Linolenic acid metabolism
    107521019 (PLA2G3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107521019 (PLA2G3)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107521019 (PLA2G3)
  09154 Digestive system
   04972 Pancreatic secretion
    107521019 (PLA2G3)
   04975 Fat digestion and absorption
    107521019 (PLA2G3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107521019 (PLA2G3)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107521019 (PLA2G3)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    107521019 (PLA2G3)
SSDB
Motif
Pfam: Phospholip_A2_2 Chromadorea_ALT Acetate_kinase
Other DBs
NCBI-GeneID: 107521019
NCBI-ProteinID: XP_016020848
LinkDB
Position
Unknown
AA seq 516 aa
MGVLGVLLGVLSLLGMVLGGSPALPWDSTFCHLARPIPGSPLGSLSFLGKDTQRLALFHA
HWDGHGRLQACSQQDEPELTAAFSALCAGEITRGSFIHTPGPELQRALATLRSQWEACQG
PDGNPAGARKKRAAGQSGVPGVGHKRGKRGWTMPGTLWCGVGDSAGNSSELGLFQGPDLC
CREHDLCPQNISPFQYNYGIRNYRFHTISHCDCDARFQQCLQNQQDSISDIVGMAFFNVL
EIPCFVLEEQEACVAWYWWGGCRMYGFIPLARLQPKTLYNASWSSPATTLTPSPQSPAPS
KLRQKQHPRKWPPQREASQHPNKANATALQAPMASLRSDMDPTVHLEVTHPGLQGPRGGL
NYQGVRQACRNFRHLDQCENQIGPRETKFQLLNSAPEPLFHCDCTRRLARFLRLHSPPVG
NNMLWQLLGTTCFKLVPPLDCAEHKGCSRGPKAIKVSARHLWRLQQRRLQIWGTGTDEEQ
ARPSAHPRAPTSFYDWCLQLTQAAREPKEQQKFWKQ
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgggggttctgggagtgctgttgggggtgctgagcctcctgggaatggttctggggggt
tctcctgccctcccctgggacagcaccttttgccacttggccaggcccatccctggcagc
cccttggggtccctgagcttcttgggcaaggacacccagagactggccctgttccatgcc
cactgggatgggcacgggaggctgcaagcatgtagccagcaggatgagccagagctcacc
gcagccttcagtgccctctgtgctggtgagatcacccggggctccttcatccacacccct
gggcctgagctgcagagagccctggccacccttcggagtcagtgggaggcctgccaaggg
cctgatgggaatccagcaggggcaaggaagaagcgagcagcaggacagagtggagtacct
ggtgtagggcacaagcgggggaagagaggctggaccatgcctggcacgctgtggtgtgga
gtcggggactctgctggaaattcctcggagctggggctcttccagggcccggatctctgc
tgccgggaacatgatctctgcccacagaacatctcgcctttccagtacaactatggcatc
cgaaactaccggttccacaccatctcccactgcgactgtgatgccaggttccagcaatgc
ctgcagaaccagcaggactccatctccgacatcgttggcatggctttcttcaatgtgctg
gagatcccctgctttgtgctggaggagcaggaggcgtgtgtggcatggtactggtggggc
gggtgtagaatgtatggcttcatacccctcgcccgcctgcagcctaagaccctctacaat
gcctcctggagctccccagccactaccctgactcctagcccccagagcccagcccccagc
aagctgagacagaagcagcaccctcggaagtggccaccacagagggaagcatcccagcac
ccaaacaaagccaacgccacagcccttcaggcccccatggcctccctcaggtctgatatg
gaccccacagtccatctggaggtcacccatccaggcctccaggggccacggggtggccta
aactaccagggcgtccgccaggcctgccgcaacttccgccatctagaccagtgtgagaac
cagattgggccccgggagaccaagttccagctactcaatagtgccccagagccactcttc
cattgcgactgcacacgccgactggcacgcttcctgaggctccacagcccacctgtgggc
aacaacatgctttggcagctgctgggcacaacctgcttcaagctggttcctccattggac
tgtgctgagcacaaaggctgttccaggggccctaaggccatcaaggtgtcagctaggcac
ttgtggcgacttcagcagaggagactccagatctggggtacaggcacagatgaggagcag
gcacggccttcagcgcacccaagggcccccacgtcattctatgattggtgcctgcagctg
acccaggcagcccgagaacccaaagagcagcagaaattctggaaacagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521615
Entry
107521615         CDS       T06036                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00564  Glycerophospholipid metabolism
ray00565  Ether lipid metabolism
ray00590  Arachidonic acid metabolism
ray00591  Linoleic acid metabolism
ray00592  alpha-Linolenic acid metabolism
ray01100  Metabolic pathways
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04072  Phospholipase D signaling pathway
ray04217  Necroptosis
ray04270  Vascular smooth muscle contraction
ray04370  VEGF signaling pathway
ray04611  Platelet activation
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04724  Glutamatergic synapse
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04921  Oxytocin signaling pathway
ray05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    107521615 (PLA2G4A)
   00565 Ether lipid metabolism
    107521615 (PLA2G4A)
   00590 Arachidonic acid metabolism
    107521615 (PLA2G4A)
   00591 Linoleic acid metabolism
    107521615 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    107521615 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107521615 (PLA2G4A)
   04014 Ras signaling pathway
    107521615 (PLA2G4A)
   04370 VEGF signaling pathway
    107521615 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    107521615 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107521615 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107521615 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    107521615 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    107521615 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107521615 (PLA2G4A)
   04913 Ovarian steroidogenesis
    107521615 (PLA2G4A)
   04921 Oxytocin signaling pathway
    107521615 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107521615 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    107521615 (PLA2G4A)
   04726 Serotonergic synapse
    107521615 (PLA2G4A)
   04730 Long-term depression
    107521615 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107521615 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    107521615 (PLA2G4A)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     107521615 (PLA2G4A)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 107521615
NCBI-ProteinID: XP_016021941
LinkDB
Position
Unknown
AA seq 741 aa
MFLVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISSTPDSRKRTRHFNNDIN
PVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFPISFMKVGEKKEVPFIFNEVT
EMILEMSLEVCSSPDLRFSMALCDQEKAFRYRRKENIRENMKKLLGPENSEGLSSTRDVP
VVAILGSGGGFRAMVGFSGVMKALYESGILDCTTYVAGLSGSTWYMSTLYSHPDFPEKGP
EEINEELMKNVSYNPLLLLTPQKVKRYVESLWKKKRSGQPVTFTDIFGMLIGETLIHNRM
NITLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFMAPDLF
GSKFFMGKVVKKYEENPLHFLMGVWGSAFSILFNRVLGVSSSQNKGSTMEEELENITAKH
IVSNDSSDSDDESQEPKGTENEDAERDYQNDNQASWVHRMIMALMSDSALFNTREGRAGK
VHNFMLGLNLNTSYPLSPFRDFTTQESLDEDELDAAVADPDEFEQIYEPLDVKSKKIHVV
DSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMNKLPFPKID
PYVFDREGLKECYVFKPKNPDVEKDCPTIIHFVLANINFRKYKAPGVPRETTEEKEIADF
DIFDDPESPFSTFNFQYPNQAFKRLHDLMYFNTLNNIDVIKNAIIESIEYRRQNPSRCSV
SLSNIEARKFFNKEALSKPTA
NT seq 2226 nt   +upstreamnt  +downstreamnt
atgtttctagtggagcaccagtattcccacaagttcacagtagtggtgttacgtgccacc
aaagtgacaaagggggccttcggtgacatgcttgacactccagacccctacgtggaactt
ttcatctcctcaactcccgacagcaggaagagaacgagacactttaataatgacataaac
cctgtgtggaatgagacctttgaatttattttggacccgaatcaggaaaatgttttggag
atcacgttaatggatgccaattatgtcatggatgaaactcttggaacagcaacgtttccc
atatcttttatgaaagtaggagagaagaaagaggttccttttattttcaacgaagtcact
gaaatgatcctggaaatgtcccttgaagtttgctcatccccagacctccgatttagcatg
gctctgtgtgatcaggagaaagctttcaggtaccggaggaaagaaaacatcagggaaaac
atgaagaaactcctgggtccggagaacagcgaaggcttgtcttctacacgcgatgtacct
gtggtcgccatactgggctcaggtggagggtttcgagccatggtaggattctccggcgtg
atgaaggcactgtatgaatcaggaattttggattgcactacttatgttgctggtctttct
ggctccacatggtacatgtcaaccttatattctcaccctgattttccagagaaagggcca
gaggagattaatgaagagctaatgaaaaatgttagctataacccccttttacttctcaca
ccacagaaagttaagagatatgttgagtctttatggaagaagaaaaggtctggacaacct
gtcacctttacggatatctttggaatgttaataggagaaacactaattcacaatagaatg
aacattaccttgagtagtttgaaggaaaaagtcaatactgcacaatgccctttacctctt
ttcacctgtctgcatgtcaaacctgatgtttcagaactgatgtttgcagattgggttgaa
tttagtccgtatgagattggcatggctaaatacggtacttttatggctcctgacttattt
ggaagcaaattttttatgggaaaagttgtgaagaaatacgaagaaaaccccttgcatttc
ctaatgggtgtctggggcagcgccttttctatattgttcaacagagtcttgggagtttcc
agttcacaaaataaaggttccaccatggaggaagaattagaaaacattacggcaaagcat
attgtgagtaatgatagctcagatagcgatgatgaatcacaagaacccaaaggcactgaa
aatgaagatgccgaaagagactatcaaaatgataatcaagcaagttgggtccatcgtatg
ataatggccttgatgagcgattcagctctattcaataccagagaaggacgtgctgggaag
gttcacaacttcatgctgggcttgaatctcaatacatcttatccactgtctcctttcaga
gacttcaccacacaggagtccttggatgaagatgaacttgatgcagctgtagcagatcct
gatgaatttgagcaaatatatgagcctctggatgtcaaaagtaaaaagattcacgtagta
gacagtggcctcacatttaacctaccttatcccttgatcctgagacctcagaggggagtt
gatctcatcatctcctttgacttttctgcaagaccaagtgactctagtcctccgttcaag
gaacttctacttgcagaaaaatgggctaaaatgaacaagcttccctttccaaagattgac
ccttatgtgtttgatcgagaaggactaaaggagtgttatgtctttaaacccaagaatcct
gatgtagagaaagattgcccgacgatcattcacttcgttctggccaacatcaacttcaga
aagtacaaggctccaggtgttccaagagaaactacagaagagaaagaaatagctgatttt
gatatttttgatgacccggaatcaccgttttcaaccttcaacttccaatatccaaatcaa
gcattcaaaaggctgcatgatctgatgtacttcaacaccctgaacaacatcgatgtaata
aagaatgccatcattgaaagcatcgaatacagaaggcagaatccatctcgctgttctgtt
tccctcagtaacattgaggcaagaaaatttttcaacaaggaggctctaagcaaacccaca
gcataa

DBGET integrated database retrieval system