KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501228
Entry
107501228         CDS       T06036                                 

Definition
(RefSeq) paxillin isoform X1
  KO
K05760  paxillin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray05100  Bacterial invasion of epithelial cells
ray05135  Yersinia infection
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05203  Viral carcinogenesis
ray05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107501228
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107501228
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107501228
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107501228
   04062 Chemokine signaling pathway
    107501228
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107501228
   05203 Viral carcinogenesis
    107501228
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107501228
   05100 Bacterial invasion of epithelial cells
    107501228
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107501228
   05163 Human cytomegalovirus infection
    107501228
   05165 Human papillomavirus infection
    107501228
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107501228
Domain-containing proteins not elsewhere classified [BR:ray04990]
 LIM domain-containing proteins
  Paxillin family proteins
   107501228
SSDB
Motif
Pfam: Paxillin LIM
Other DBs
NCBI-GeneID: 107501228
NCBI-ProteinID: XP_015982643
LinkDB
Position
Unknown
AA seq 642 aa
MGTLHEARAEVWPWKGHWDWPWTLVPFLLLPRHILTPSSSGLLETGSQTSSKGPGGGVGT
DLPQKSGDLRWAAGSGVLDLGTSFPSEQLDALLEDLESTTSHISTRPVFLSEETPYAYPA
GNHTYQEVAVPPPVPPPPSSEALNGTILDSLDQWQPGASRFIHQQPQSPPPTHGSSAKTS
SASIPQDGLGPPCPRGGEEEHVYSFPNKQKSAEPSPAMMSSSLGSNLSELDRLLLELNAV
QHNSPGFPADEANSSPLLPGALSPHYGIPENNSPLGGKTGPLMKEKPKRNGGRGLEDVRP
SVESLLDELESSVPSPVPAITVNQGEMSSPQRATSSQQQTRISASSATRELDELMASLSD
FKFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQV
VTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHSLFSPRCYYCNGPILDKVV
TALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYIS
ALNTLWHPECFVCRECFTPFINGSFFEHDGQPYCEVHYHERRGSLCSGCQKPITGRCITA
MAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC
NT seq 1929 nt   +upstreamnt  +downstreamnt
atggggactctacatgaagccagggcagaggtgtggccatggaagggccactgggattgg
ccctggacactggttccttttctgctgttacctagacacatactgactccctctagttcc
ggtttgctagagacaggaagccagacctcttccaaaggacctggagggggagtaggaact
gaccttcctcagaagtcaggggacctgcgctgggcagcggggtccggggtcctggacctt
ggaacaagctttccctctgaacagctggacgccttgctggaggacttggagtccaccacc
tcgcacatctccacacggcccgtgttcttgtccgaggagaccccctacgcctacccagct
gggaaccacacgtaccaggaggtcgctgtgccaccccctgtcccgccacccccatccagc
gaggccctcaatggcacgatccttgactccttagaccagtggcagcccggcgcctcccga
ttcattcaccagcagcctcagtccccaccgcccacgcacggctccagtgccaaaacgtcc
agtgcctccatcccccaggacggcctcggccctccatgcccccgaggcggcgaggaagag
cacgtctacagctttcccaacaagcagaagtcggcggagccttcgcctgccatgatgagc
tcctccctgggcagcaacctgtccgaactggaccgcctgctgctggaactgaatgcggtg
cagcacaactccccaggcttccccgcggatgaggccaactcaagccccctgctgcctggg
gctctgagtcctcactatggcatcccggagaataacagcccgctgggaggcaaaactggg
cccctgatgaaagagaagcccaagcggaacggaggccggggcctggaggacgtgcggccg
agcgtggagagcctcctggatgaactggagagctccgtgcccagccctgtccccgccatc
actgtgaatcagggggagatgagcagccctcagcgcgccacctctagccagcagcagacg
cgcatctcggcctcctctgccaccagggagctggacgagctgatggcctcgctgtcggat
tttaagttcatggcgcaggggaagacagggagcagctctcccccaggagggccccccaag
cctgggagccagctggacagcatgctggggagcctgcagtctgacctgaacaaacttggg
gtcgccacggttgccaaaggggtctgcggagcctgcaagaagcccatcgctgggcaggtc
gtgactgccatggggaagacgtggcacccagaacacttcgtctgcacccactgccaggag
gagatcgggtcccggaacttctttgagcgggatggacagccgtactgtgaaaaggactac
cacagcctcttctccccgcgctgctactactgcaacggtcccatcctggacaaagtggtg
acagccctcgaccgcacgtggcaccctgagcacttcttctgtgcccagtgtggcgccttc
ttcggccctgaagggttccacgagaaagacggcaaggcctactgccggaaggattacttc
gacatgtttgcgcccaagtgtggtggctgcgcccgggccatcctggagaactacatctcg
gcacttaacaccctctggcaccccgagtgctttgtgtgccgggaatgcttcacgccattc
atcaacggcagcttcttcgagcacgacgggcagccctactgtgaggtgcactaccacgag
cggcgaggctcgctgtgctccggctgccagaagcccatcacgggccgctgcatcaccgcc
atggccaagaagttccacccggagcacttcgtctgtgccttttgcctcaagcagctcaac
aagggcaccttcaaggagcagaacgacaagccttactgtcagaactgcttcctcaagctc
ttctgctag

DBGET integrated database retrieval system