KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501389
Entry
107501389         CDS       T06036                                 

Gene name
ARHGEF6
Definition
(RefSeq) rho guanine nucleotide exchange factor 6 isoform X1
  KO
K05729  Rho guanine nucleotide exchange factor 6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04810  Regulation of actin cytoskeleton
ray05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107501389 (ARHGEF6)
 09160 Human Diseases
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107501389 (ARHGEF6)
Membrane trafficking [BR:ray04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    107501389 (ARHGEF6)
SSDB
Motif
Pfam: RhoGEF67_u2 betaPIX_CC RhoGEF RhoGEF67_u1 CH SH3_2 SH3_9 SH3_1 PH CAMSAP_CH Nsp1_C ZapB
Other DBs
NCBI-GeneID: 107501389
NCBI-ProteinID: XP_015982979
LinkDB
Position
Unknown
AA seq 769 aa
MNPEERIVTWLISLGVLDSPKKTICDPEEFLKSSLKNGVVLCKLISRLRPGSVEKYCLEP
QTEADCINNINDFLKGCVTLQVEVFDPDDLYSGVNFSKVLSTLLAVNKATEDQLSERPCG
RSSSLSAAYSSQTNPQGAVSSTAPGLQRQSKAVEMTENGSHQLIVKARFNFKQTNEDELS
VCKGDIIYVTRVEEGGWWEGTLNGRTGWFPSNYVREIKSSERPLSPKAVKGFETTPLTKN
YYSVVLQNILDTEKEYAKELQSLLVTYLRPLQSNNNLSTVEFTSLLGNFEEVCTFQQTLC
QALEECSKFPENQHKVGGCLLNLMPHFKSMYLAYCANHPSAVNVLTQHSDDLEQFMENQG
ASSPGILILTTSLSKPFMRLEKYVTLLQELERHMEDTHPDHQDILKAIIAFKTLMGQCQD
LRKRKQLELQILSEPIQAWEGEDIKTLGNVIFMSQVMVQYGTCEEKEERYLMLFSNVLIM
LSASPRMSGFIYQGKIPIAGMVMTRLDEIEGNDYIFEITGNIIERIVVHCNNNQDFQEWL
EQLCRLIRGPASCSSLSKTSLSSCSAHSSFSSTGQTRGPLEPPQIIKPWSLSCLRPAPPL
RPSAALGYKEESSKSPKTMKKFLHKRKTERKPSEEEYVIRKSTAALEEDAQILKVIEAYC
TSANFQQGHSSSARKDSVPQVLLPEEEKLIIEETRSNGQTIIEEKSLVDTVYALKDEVKE
LKQENKRMKQCLEEELKSRRDLEKLVRRLLKQTDECVRAESSSKTSILP
NT seq 2310 nt   +upstreamnt  +downstreamnt
atgaatccagaagagcgaatcgtgacatggcttatatccttgggagttttagattcccca
aaaaagaccatctgtgatccggaggagttcttgaagtcctcgctgaaaaatggggtagtg
ttgtgcaagctgatcagcagactgaggcctggctctgtagaaaagtactgtctggagccc
caaacagaagccgattgcatcaacaatatcaacgacttcctgaaaggatgcgtaaccctt
caagtggaggtatttgatcctgatgacctttattcaggagtcaatttctccaaggttctg
agcactcttttagctgtcaacaaagcaacagaagatcaactatcagaaagaccatgtgga
cgttcctcttctcttagtgctgcttatagttctcagacaaacccacagggagccgtttct
agcacagctccagggctgcagaggcagtcaaaggcagtggagatgacggaaaatggaagt
catcagttgatagtaaaggcaagattcaactttaagcagaccaatgaagatgaactgtca
gtctgtaaaggggacatcatctatgtcactagggttgaagaaggaggctggtgggaaggc
acgttaaatgggagaacaggctggtttcctagtaattatgtccgagaaattaaatccagt
gagagacctctttcccccaaggctgtcaaaggatttgaaaccactccacttaccaagaat
tattattctgtggtgttacagaacattctggacactgaaaaagaatatgctaaagaactt
cagtctcttcttgttacgtacttaagacccctgcagtccaataacaatctgagtactgtg
gagtttacatctttattgggaaactttgaggaagtatgcacatttcaacagacgctctgc
caagccttggaagaatgttcaaagtttccagaaaaccaacacaaagtaggaggttgtctg
ctgaacctcatgcctcattttaaatccatgtatctggcttactgtgcaaatcatccttca
gctgtaaatgtactcactcaacacagtgatgatctagagcaatttatggaaaatcaaggt
gcatccagcccaggtatcctcattttaacaacaagcctcagcaaaccattcatgcgactg
gagaagtatgttactctcttgcaagagttggaacggcatatggaggatacgcatccagat
catcaggatattctgaaagcaatcatagcgttcaaaactcttatggggcagtgccaagat
ttaagaaagagaaaacagctagagttgcagatactgtctgaacctattcaggcatgggaa
ggcgaggatattaaaaccttgggaaatgtgatttttatgtcacaagtaatggtgcagtat
ggaacatgtgaggaaaaagaagaacggtacctcatgttattttcaaatgtcttaataatg
ttatctgcaagtcctcggatgagtggctttatctatcagggaaaaataccaatagcagga
atggtgatgactagattagatgaaattgaagggaatgactacatatttgaaatcacaggt
aacataatagagagaattgtggttcattgcaacaacaaccaggatttccaagaatggctg
gaacagctgtgcagacttattagaggacctgcctcctgcagttcgttatccaagacatca
ttgtcatcttgtagtgctcattcttcttttagttctaccggacagactcgaggacccttg
gagcctcctcaaattataaaaccatggagtttaagttgtctacgacctgcacctccactt
agaccatcagcagctctaggttataaagaggagtctagtaaaagccccaaaacgatgaag
aaatttcttcataaaagaaagaccgaaagaaagccatcagaggaggaatatgtgattcgg
aaaagtacagctgctctggaagaagatgctcagattcttaaagtgatcgaagcctactgt
accagcgcaaactttcaacaaggccatagctcaagtgctcgcaaggattcagttccacaa
gtcttactccccgaggaagagaaactcatcattgaagaaaccagaagcaacggccagacc
atcattgaagaaaagagcctcgttgacacagtttatgccttgaaggatgaggtcaaagaa
ctgaaacaggagaataaaagaatgaagcaatgcttggaagaagaattgaaatcaagaagg
gacctagaaaagctggtccggaggctgctgaagcaaactgatgaatgcgttcgggctgag
tccagtagcaagacctccattcttccataa

DBGET integrated database retrieval system