KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501399
Entry
107501399         CDS       T06036                                 

Gene name
CD40LG
Definition
(RefSeq) CD40 ligand
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04064  NF-kappa B signaling pathway
ray04514  Cell adhesion molecules
ray04660  T cell receptor signaling pathway
ray04672  Intestinal immune network for IgA production
ray05144  Malaria
ray05145  Toxoplasmosis
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05322  Systemic lupus erythematosus
ray05330  Allograft rejection
ray05340  Primary immunodeficiency
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107501399 (CD40LG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107501399 (CD40LG)
   04514 Cell adhesion molecules
    107501399 (CD40LG)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107501399 (CD40LG)
   04672 Intestinal immune network for IgA production
    107501399 (CD40LG)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    107501399 (CD40LG)
   05322 Systemic lupus erythematosus
    107501399 (CD40LG)
   05320 Autoimmune thyroid disease
    107501399 (CD40LG)
   05330 Allograft rejection
    107501399 (CD40LG)
   05340 Primary immunodeficiency
    107501399 (CD40LG)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107501399 (CD40LG)
  09174 Infectious disease: parasitic
   05144 Malaria
    107501399 (CD40LG)
   05145 Toxoplasmosis
    107501399 (CD40LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107501399 (CD40LG)
   04090 CD molecules [BR:ray04090]
    107501399 (CD40LG)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Tumor necrosis fators
   107501399 (CD40LG)
CD molecules [BR:ray04090]
 Proteins
  107501399 (CD40LG)
SSDB
Motif
Pfam: TNF DUF5677
Other DBs
NCBI-GeneID: 107501399
NCBI-ProteinID: XP_015983003
LinkDB
Position
Unknown
AA seq 260 aa
MIETYSQTSPRSVASGPPVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKMIQRCNKGERSLSLLNCEEIRSQFEAFVKDIMGNEVKEKKEKFQMQKGDQDPQ
IAAHVISEASSKTASVLQWAQKGYYTMSNNLVSLENGKQLAVKRQGLYYIYAQVTFCSNR
EASSQAPFIASLCLRSMSGSERILLRATNTQSSSKPCGQQSIHLGGVFELQPGASVFVNV
TDPSQVSHGTGFTSFGLLKL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgatcgaaacatacagccaaacttctcctcgatctgtggccagcggaccacctgtcagt
atgaaaatttttatgtatttacttactgtttttcttatcacccagatgattgggtcagca
ctttttgctgtgtatcttcacagaagattggacaagatagaagatgaaaggaatcttcat
gaagatttcgtgttcatgaaaatgatacagagatgcaacaaaggagagaggtccttatcc
ttactgaactgtgaggaaattagaagccagtttgaagctttcgtcaaggatataatggga
aatgaagtgaaggagaaaaaagaaaagtttcaaatgcaaaaaggtgatcaggatcctcaa
attgcagcacatgtcataagtgaagccagtagtaaaacagcatctgtcctacagtgggcc
caaaaaggatactacaccatgagcaacaacttggtaagcctggaaaatgggaaacaactg
gccgttaaaagacaaggactctattacatctatgcccaagtcaccttctgttccaatcgg
gaagcttcaagtcaagctccatttatagccagcctctgcctcaggtcaatgagtggatcc
gagagaatcttactgagagcgacaaatacccagagttcctccaaaccttgtgggcaacag
tccattcacttgggaggagtattcgaattgcaacccggtgcttctgtgtttgtcaacgtg
actgatccaagccaagtgagccatgggaccggcttcacatcttttggcttactcaaactc
tga

DBGET integrated database retrieval system