KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501405
Entry
107501405         CDS       T06036                                 

Gene name
PRKCI
Definition
(RefSeq) protein kinase C iota type
  KO
K06069  atypical protein kinase C iota type [EC:2.7.11.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04144  Endocytosis
ray04390  Hippo signaling pathway
ray04530  Tight junction
ray04611  Platelet activation
ray04910  Insulin signaling pathway
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107501405 (PRKCI)
   04390 Hippo signaling pathway
    107501405 (PRKCI)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107501405 (PRKCI)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107501405 (PRKCI)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107501405 (PRKCI)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107501405 (PRKCI)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107501405 (PRKCI)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107501405 (PRKCI)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107501405 (PRKCI)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 C1_1 Pkinase_C Kinase-like Kdo APH C1_2
Other DBs
NCBI-GeneID: 107501405
NCBI-ProteinID: XP_015983017
LinkDB
Position
Unknown
AA seq 596 aa
MPTQRDSTTMSHPIAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCSEVRDMCSF
DNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGE
DKSIYRRGARRWRKLYCANGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHK
KCHKLVTIECGRHSLPPEPMMPMDPSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTR
ESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQ
TEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSA
EISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIR
IPRSLSVKAASVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFK
PNISGEFGLDNFDSQFTNEPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgccgacccagagggacagcacaaccatgtctcacccgatcgcaggcggcggcagcggg
gaccattcgcaccaggtccgggtgaaagcttactatcgcggggatatcatgataacacat
tttgaaccttcaatctcctttgagggcctttgcagtgaggttcgagacatgtgctctttt
gacaatgaacagcttttcactatgaaatggatagatgaggaaggagacccgtgtacagta
tcatctcagctggagttagaagaagcctttaggctttatgagctaaacaaggactctgaa
ctcttgattcatgtctttccttgcgtaccagaacgtcctggaatgccctgtccaggagaa
gataaatccatctaccgcagaggtgcacgccgatggagaaagctgtattgtgcaaatggc
cacacttttcaagccaagcgtttcaacaggcgtgcccactgtgccatctgtactgatcga
atatggggactaggacgccagggatataagtgcatcaattgcaaactcttggttcataag
aagtgccacaaacttgtcacaattgaatgtgggcggcattctttgccaccggagccaatg
atgcccatggatccatcatccatgcactcagaccatgcacagacagtaattccatataat
ccttcaagtcatgagagtttggaccaagttggtgaagaaaaggaggcaatgaacaccagg
gaaagtggcaaagcttcatccagtctaggtcttcaggattttgatttgctccgggtaata
ggaagaggaagttatgccaaagtactattggtgcgattaaaaaaaacagatcgtatttat
gcaatgaaggttgtgaaaaaagagcttgtcaatgatgatgaggatattgattgggtacag
acagagaagcatgtttttgagcaagcatccaatcatccttttcttgttgggctgcattct
tgctttcagacagaaagcagattgttctttgtcatagagtatgtaaatggaggagatcta
atgtttcatatgcagcgacaaagaaaacttcctgaagaacatgccagattttactctgca
gaaatcagtctagcattaaattatcttcatgaacgagggataatttatagagatttgaaa
ttggacaatgtattgctggactcggaaggacacattaaactcactgactacggcatgtgt
aaggaaggattacggccaggagatacaaccagcactttctgtggtactcccaattacatc
gctcctgaaattttaagaggagaagattatggattcagtgttgactggtgggctcttgga
gtactaatgtttgagatgatggcaggaaggtctccatttgatattgttgggagctctgat
aaccctgatcaaaacacagaagattatctcttccaagttattttggaaaaacaaattcgc
ataccacgttctctgtctgtaaaagctgcaagtgtcctgaagagttttctcaacaaggac
ccaaaggaacgattaggttgtcatcctcaaacaggatttgctgatattcagggacaccca
ttcttccgaaatgttgattgggatatgatggagcaaaagcaggtggtacctccttttaaa
ccaaatatttctggggaatttggtttggacaactttgattctcagtttactaatgaacct
gtccagctcactccagatgatgatgatatcgtaaggaagattgatcagtctgaatttgaa
ggttttgaatatatcaatcctcttttgatgtcagcagaagaatgcgtctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107510685
Entry
107510685         CDS       T06036                                 

Gene name
PRKCZ
Definition
(RefSeq) protein kinase C zeta type
  KO
K18952  atypical protein kinase C zeta type [EC:2.7.11.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04062  Chemokine signaling pathway
ray04071  Sphingolipid signaling pathway
ray04144  Endocytosis
ray04360  Axon guidance
ray04390  Hippo signaling pathway
ray04530  Tight junction
ray04611  Platelet activation
ray04910  Insulin signaling pathway
ray04926  Relaxin signaling pathway
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05165  Human papillomavirus infection
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107510685 (PRKCZ)
   04390 Hippo signaling pathway
    107510685 (PRKCZ)
   04071 Sphingolipid signaling pathway
    107510685 (PRKCZ)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107510685 (PRKCZ)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107510685 (PRKCZ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107510685 (PRKCZ)
   04062 Chemokine signaling pathway
    107510685 (PRKCZ)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107510685 (PRKCZ)
   04926 Relaxin signaling pathway
    107510685 (PRKCZ)
  09158 Development and regeneration
   04360 Axon guidance
    107510685 (PRKCZ)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107510685 (PRKCZ)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107510685 (PRKCZ)
   04931 Insulin resistance
    107510685 (PRKCZ)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107510685 (PRKCZ)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107510685 (PRKCZ)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107510685 (PRKCZ)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107510685 (PRKCZ)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 PB1 Pkinase_C Kinase-like APH Kdo C1_2
Other DBs
NCBI-GeneID: 107510685
NCBI-ProteinID: XP_015999913
LinkDB
Position
Unknown
AA seq 582 aa
MKGGANGKSLRLSRDMLITSVDAASTFEELCEEVRDMCSLRQGQPLTLKWVDSEGDPCTV
SSQMELEEAFRLCSQHRDVGLTVHVFPSSPEQPGMPCPGEDKSIYRRGARRWRKLYRANG
HLFQAKRFNRRAYCGQCSERIWGLARQGYRCVNCKLLVHKRCHVLVPLTCRRHMDSVMPS
QEPAVDDKDDDVDLPSEETGGITYISSTRKRDSLKDDSEALKPVIDGMDGIKISQGLGLQ
DFDLIRVIGRGSYAKVLLVRLKKSDQVYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSN
PFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEICVALNFLHER
GIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAPEILRGEEYGF
SVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRFLSVKASHVLK
GFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQALPPFQPQITDDYGLDNFDT
QFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLPTEESV
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgaaagggggagcgaatggaaagtccttgaggttgtccagggacatgctgatcaccagc
gtggacgcggccagcaccttcgaggagctctgcgaggaagtcagggacatgtgcagcctc
cgccaggggcagccgctcaccctcaagtgggtggacagtgaaggcgacccctgcaccgtg
tcctcgcagatggagctggaggaggccttccgcctgtgcagccagcacagggacgtcggg
ctcaccgttcacgttttcccgagcagccccgagcagcccggcatgccctgcccaggagag
gacaaatccatctaccgccgcggagccagaagatggaggaagctgtaccgcgccaacggc
cacctcttccaagccaagcgctttaacaggagggcgtactgcggccagtgcagcgagagg
atatgggggctcgcgcggcagggctacaggtgcgtcaactgcaagctgctggtccataaa
cgctgccacgtcctcgtcccgctgacctgcaggaggcatatggattctgtcatgccttcc
caagaacctgcagtggacgacaaggacgacgacgtggaccttccttccgaggagaccggt
ggaatcacttacatttcttccacccggaagcgtgacagcctcaaagatgactccgaggcc
ctcaaaccggttatcgacgggatggacgggatcaaaatctctcaggggctggggctgcag
gacttcgacctgatccgggtcatcgggcgcgggagctacgccaaggtgctcctggtgcgg
ctcaagaagagcgaccaggtgtacgccatgaaggtggtgaagaaggagctggtgcacgac
gacgaggacatcgactgggtgcagacggagaagcacgtgttcgagcaggcgtccagcaac
ccgttcctggtcggcttgcactcctgcttccagacgacgagccggctgttcctggtcata
gagtacgtcaacggcggggacctcatgttccacatgcagagacagaggaagcttccggag
gagcatgccagattctacgccgccgagatctgcgtcgccctcaacttcctgcacgagaga
gggatcatctaccgggacctgaagctggacaacgtgctgctggacgccgacggccacatc
aagttgacagactacggcatgtgcaaggagggcctgggccccggtgacacgacgagcact
ttctgcggaaccccaaactacatcgccccggaaatcctgcggggggaggagtacgggttc
agcgtggactggtgggcgctgggcgtcctgatgttcgagatgatggccgggcgctccccc
ttcgacatcatcaccgacaaccccgacatgaacaccgaggactacctgttccaagttatc
ctggagaagcccatccggatcccaaggttcctgtcggtcaaagcctcccacgtcttgaaa
ggatttttaaacaaggaccccaaagagaggctcggctgccggccgcagaccggattctcc
gacatcaagtcccacgcattcttccgcagcatagactgggacctgctggagaagaagcag
gcgctgccgccgttccagccgcagatcaccgacgactacgggctggacaacttcgacacg
cagttcaccagcgagccggtgcagctgacccccgacgacgaggatgtcataaagcggatc
gaccagtcggagttcgaggggttcgagtacatcaacccgctgctgctccccaccgaggag
tccgtgtga

DBGET integrated database retrieval system