KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501411
Entry
107501411         CDS       T06036                                 

Gene name
SLC2A2
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 2 isoform X1
  KO
K07593  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04911  Insulin secretion
ray04917  Prolactin signaling pathway
ray04922  Glucagon signaling pathway
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04950  Maturity onset diabetes of the young
ray04973  Carbohydrate digestion and absorption
ray05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107501411 (SLC2A2)
   04922 Glucagon signaling pathway
    107501411 (SLC2A2)
   04917 Prolactin signaling pathway
    107501411 (SLC2A2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    107501411 (SLC2A2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    107501411 (SLC2A2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107501411 (SLC2A2)
   04950 Maturity onset diabetes of the young
    107501411 (SLC2A2)
   04931 Insulin resistance
    107501411 (SLC2A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107501411 (SLC2A2)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   107501411 (SLC2A2)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    107501411 (SLC2A2)
SSDB
Motif
Pfam: Sugar_tr MFS_1 Phage_holin_2_3
Other DBs
NCBI-GeneID: 107501411
NCBI-ProteinID: XP_015983027
LinkDB
Position
Unknown
AA seq 523 aa
MNSFKPVTGTLVFAILTAVLSSFKFGYDIGVINAPQEVIVSHYRHVLGVPPDDQKAVDDY
ASTQELPTAPYLRNPTLSPEAEEEPTASAGLVTMFWSLSVSSFAIGGMIASFFGGWLGDK
LGRIKAMLVANILSFTGALLMGFSKMGPSHILIIAGRSISGLYCGIISGLIPIYIGEIAP
TALRGAIGTLHQLAIVTGILVSQIVGLDFILGNHELWHILLGLTAVPSLLQSVMLFFCPE
SPRYLYIKLDEEEKARQSLKRLRGGVDVTKDITEMRNEREEAMREQKVSIIQLFTNSSYR
QPILVALLLHLTQQFSGINGIFYYSTSIFQTAGVGQPVYATIGVGAINTVFTAVSVFLVE
KAGRRSLFLIGMGGMFFCAIFMSVGLVLLDKLSWMSYVSMIAIFLFVSFFEIGPGPIPWF
MVGEFFNQGSRSAAMAVAAFCNWACNFFIALCFPYIAGFCGPYVFFLFAGTMLAFTLVTF
FKVPETKGKSFEEIAEEFRKKSGSTQAAKAATEMKFLRATETA
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgaattcattcaagccggtcactgggacattggttttcgctatcctcactgctgtgctt
agttctttcaagtttggatacgacatcggtgtgatcaatgcccctcaagaggtaatagta
tcccattatagacatgttttgggtgttccaccggatgaccaaaaagctgtcgacgactat
gccagtacacaagaactacccacagccccatacctaaggaatccaacactaagccctgag
gctgaggaagagcctacggcatctgctggcctcgtcaccatgttctggtccctgtctgtg
tccagctttgcaattggtggaatgatagcatcattctttggtgggtggcttggagacaag
cttggaagaatcaaagccatgttggtagcaaacattctctcatttactggagctctcttg
atggggttttcgaaaatgggaccttctcacattcttataattgcaggaagaagcatatca
ggactctactgtgggataatttcaggcttgattccaatatacattggtgaaattgctcca
accgcactcaggggtgctattggcactcttcaccagctggccattgtcacaggcattctt
gttagtcagattgttggccttgactttatcctgggcaatcatgagctgtggcacatcctg
cttggtctgaccgctgtgccaagtctcctccagtctgtgatgctcttcttctgtcctgaa
agccccagatacctttacatcaagttagatgaagaagaaaaagcaaggcaaagcttgaaa
agactcagaggaggtgttgatgtcaccaaagacatcactgagatgagaaatgaaagagaa
gaagcaatgagagaacagaaagtctccataattcagctcttcaccaactccagctaccga
cagcctattctagtggcattgctgctacacctgactcagcagttttctggaatcaatggg
atcttttactactcaaccagcatttttcagacagctggagtcggccaaccggtttatgca
accattggagttggtgccatcaatacagttttcactgctgtctctgtattccttgtggag
aaggcaggacgacgctctctgtttctaatcggaatgggcgggatgtttttctgtgccatc
ttcatgtctgtgggacttgtgctactggataaattatcttggatgagttatgtgagcatg
atagccatcttcctttttgtcagcttcttcgaaatcgggccaggccccattccctggttc
atggtgggtgaatttttcaatcaaggatcacgctctgctgctatggcagtagctgcattc
tgcaactgggcctgcaatttttttatagctctgtgtttcccatacattgcgggcttttgt
ggaccttatgtgtttttcctctttgctggaacaatgttggcctttactctggtcacattt
ttcaaagttccagaaaccaaaggaaagtcctttgaggaaattgcggaagaatttcgaaag
aagagtggttcaacccaagcagcaaaagctgccacggaaatgaaattccttagagctaca
gagactgcgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107508288
Entry
107508288         CDS       T06036                                 

Gene name
SLC2A1
Definition
(RefSeq) solute carrier family 2, facilitated glucose transporter member 1
  KO
K07299  MFS transporter, SP family, solute carrier family 2 (facilitated glucose transporter), member 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04066  HIF-1 signaling pathway
ray04911  Insulin secretion
ray04919  Thyroid hormone signaling pathway
ray04920  Adipocytokine signaling pathway
ray04922  Glucagon signaling pathway
ray04931  Insulin resistance
ray04976  Bile secretion
ray05166  Human T-cell leukemia virus 1 infection
ray05200  Pathways in cancer
ray05211  Renal cell carcinoma
ray05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    107508288 (SLC2A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107508288 (SLC2A1)
   04922 Glucagon signaling pathway
    107508288 (SLC2A1)
   04920 Adipocytokine signaling pathway
    107508288 (SLC2A1)
   04919 Thyroid hormone signaling pathway
    107508288 (SLC2A1)
  09154 Digestive system
   04976 Bile secretion
    107508288 (SLC2A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107508288 (SLC2A1)
   05230 Central carbon metabolism in cancer
    107508288 (SLC2A1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    107508288 (SLC2A1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    107508288 (SLC2A1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107508288 (SLC2A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107508288 (SLC2A1)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   107508288 (SLC2A1)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    107508288 (SLC2A1)
SSDB
Motif
Pfam: Sugar_tr MFS_1 DUF523 BT1
Other DBs
NCBI-GeneID: 107508288
NCBI-ProteinID: XP_015995456
LinkDB
Position
Unknown
AA seq 492 aa
MDPNSKKLTGRLMMAVGGAVLGSLQFGYNTGVINAPQKVIEEFYNQTWVHRYEESISPTT
LTTLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLMINLLAFMSAVLMGFSKLGKSFE
MLILGRFIIGVYCGLTTGFVPMYVGEVSPTALRGALGTLHQLGIVVGILIAQVFGLDSLM
GNKELWPLLLSIIFIPALLQCILLPFCPESPRFLLINRNEENRAKSVLKKLRGTADVTRD
LQEMKEESRQMMREKKVTILELFRSPAYRQPLLIAVVLQLSQQLSGINAVFYYSTSIFEK
AGVQQPVYATIGSGIVNTAFTVVSLFVVERAGRRTLHLIGLAGMGGCAVLMTIALALLEK
LPQMSYLSIVAIFGFVAFFEVGPGPIPWFIVAELFSQGPRPAAIAVAGFSNWTSNFIVGM
CFQYVEQLCGPYVFIIFTVLLVLFFIFTYFKVPETKGRTFDEIASGFRQGGASQSDKTPE
ELFHPLGADSQV
NT seq 1479 nt   +upstreamnt  +downstreamnt
atggatcccaacagcaagaaattgacaggccgcctcatgatggccgtgggaggggcagtg
cttggctccctgcagtttggctacaacactggagttatcaacgccccccagaaggtgatt
gaggagttctacaaccagacatgggtccaccgctatgaagagagcatctcacccaccacg
ctcaccacactctggtccctctccgtggccatcttctctgtagggggcatgattggctcc
ttctcggtgggcctttttgttaaccgctttggccggcggaactcgatgctgatgataaac
ctgctggccttcatgtccgccgtactcatggggttctcaaaactgggcaagtcctttgag
atgctgatcctgggccgcttcatcatcggtgtgtactgcggcctgaccacaggcttcgtg
cccatgtatgtgggagaggtgtccccgacagcccttagaggggcgctgggcaccctgcac
cagctgggcatcgtcgtcggcatcctcattgcccaggtgtttggcctggactccctcatg
gggaacaaggagctgtggcccctgctgttgagcatcatcttcatcccggccttgctgcag
tgcatcctgctgcccttctgccccgagagcccccgcttcctgctcatcaaccgcaatgag
gagaaccgggccaagagtgtgctgaagaagctgagagggacggcagatgtgacccgagac
cttcaggagatgaaggaggagagtcgtcagatgatgcgggagaagaaagtcaccatcctg
gagctgttccgctcgcccgcctaccgccaacccctcctcatcgctgtggtgttgcagctg
tcccagcagctgtcgggcatcaatgctgttttctattactccacaagcatcttcgagaag
gcgggggtgcagcagcctgtgtatgccaccatcggttccgggatcgtcaacacagccttc
acggtcgtatcgctctttgtggtggaacgagctggccggcggaccctgcacctcattggc
ctggctggcatgggaggctgtgccgtgctcatgaccattgccctggcactgctggagaag
ctgccccagatgtcttatctgagcatcgtagccatcttcggctttgtggccttctttgaa
gtgggtcctggccccatcccatggtttattgtggctgaactctttagccagggtcctcgc
cctgctgccattgctgttgctggcttctccaactggacctcaaatttcattgtgggcatg
tgcttccagtatgtggagcaactgtgtggtccctatgtcttcatcatcttcaccgtgctc
ctggttctattcttcatcttcacctacttcaaagttcccgagaccaaaggccggaccttc
gatgagattgcttccggtttccggcaggggggagccagccaaagtgacaagacacctgag
gagctgttccaccccctgggggctgattcccaagtgtga

DBGET integrated database retrieval system