KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501496
Entry
107501496         CDS       T06036                                 

Gene name
GLI1
Definition
(RefSeq) LOW QUALITY PROTEIN: zinc finger protein GLI1
  KO
K16797  zinc finger protein GLI1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04340  Hedgehog signaling pathway
ray05200  Pathways in cancer
ray05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107501496 (GLI1)
   04024 cAMP signaling pathway
    107501496 (GLI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107501496 (GLI1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    107501496 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107501496 (GLI1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 GLI-like
    107501496 (GLI1)
SSDB
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Other DBs
NCBI-GeneID: 107501496
NCBI-ProteinID: XP_015983183
LinkDB
Position
Unknown
AA seq 1095 aa
MFNSMTPPPVSSYGEPCCLRPLPSQGAPSMGTEGLSGLPFCHQAGLMSGPHSYGPARETN
SCTEAPFFPPPRSAVKLTKKRALSISPLSDANLDLQTVIRTSPSSLVAFINSRCASPGGS
YGHLSISTMSPSLGFPPQMTHQKGTSSSFGVQPCGPHDPTQGGMMPHPQSRGPLPTCQLK
SELDMLVSKCPEEPLEGDMSSPNSTGTQDVLLGMLDGREDLEREEKPEPESVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSLSTVEPKRERDG
GPVREESRLTVPEGTMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNTGGSTEDLSN
LDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGPRGLKLPSLTHTGTPVSRRLGPPVTLD
RRSSSSSSVSSAYTVSRRSSLTSPFPPSSPPENGASSLPGLTPAQHYLLRARYASTRGGG
TPPTAAPSWRSRAEYPGYNPNVGVTRRASDPARAADRPAPARVQRFKSLGCVHSPPTVAG
GGRSFDPPLPTSVYSPQPPSITENVTMDTRGLREEPEVGTSMMGSGLNPYMDFPPADTLG
YGGPEGAATEPYGARGPGSLPLGPGPPTNYSHNACSQQVSYPDPTPETWGELPSHSGLYP
GPKSPAGTYSQCPRLEHYGHIQVKPEQGCPMGSDSTGLGPCLNAHPNEGPPRPQTLFSHY
PQPSPPQYSQSGPYTQPTPDYLPSESRPGPDFDSPTHSTGQLKTQLVCNYVQSQQELLWE
GGGRGDPPVQEPFYQSPKFLGGSQVNPSSAKVPVATYGSGFAPNLPSHKSGSYPTPSTCH
DNFAMGTTKASHRAAAPPRLLPPLPTCYGPLKAGGTNPSCGHPEVGRLGGGPNLYPPPEG
QVCNPLDSLDLDNTQLDFVAILDEAQGLSPPPSHDQGDSSEHTPPPSGPPNMAVGNMSVL
LGSLPGETQFLNSSA
NT seq 3288 nt   +upstreamnt  +downstreamnt
atgttcaactcgatgaccccaccgccagtcagtagctatggcgaaccctgctgtctccgg
cccctccccagtcagggggcccccagcatggggacagaaggactatctggtctgcccttc
tgccaccaggccggcctcatgtctggcccccacagttatgggccagccagggagaccaac
agctgcactgaggccccattctttcctcctcctcggagtgcagtcaagttgacgaagaag
cgggcactctccatctcacctctgtcagatgccaacctggacctgcaaacagttatccgc
acctcacccagctccctcgtggccttcatcaactcacgctgtgcttctccagggggctcc
tatggtcacctctccatcagcaccatgagcccatctctgggattcccaccccagatgact
caccaaaaagggacctcgtcttcctttggggtccagccctgcggtccccatgaccccacc
caggggggaatgatgccacatcctcagtcccggggacccctcccaacttgccagctgaag
tctgagctggacatgctggttagcaagtgcccggaggagcctttggaaggtgacatgtcc
agtcccaactccacaggcacacaggatgtcctgctggggatgctggatgggcgggaagac
ctagagagagaagagaagccagagcctgaatctgtgtatgagactgactgccgttgggat
ggctgcagccaggaatttgactcccaggagcagctggtgcaccacatcaacagcgagcac
attcatggggagcggaaggagttcgtgtgccattgggggggctgctccagggagctgagg
cccttcaaagcccagtacatgctggtggtccacatgcgcagacacacaggcgagaagcca
cacaagtgcacgtttgagggatgccggaagtcatactcacgcctcgaaaatctgaagacg
cacctacggtcgcacactggtgagaagccatacatgtgtgagcacgagggctgcagtaaa
gccttcagcaatgccagcgaccgagccaagcaccagaatcggacccactccaatgagaag
ccttatgtgtgtaagctccctggctgcaccaaacgctacaccgatcccagctcgctccgg
aaacatgtcaagacagtgcatggtcccgacgcccacgtgaccaagcggcaccgaggggac
ggccctctgccccgggcaccatccctttccactgtggagcccaagagagagcgggatgga
ggccccgtcagggaggagagcagactgactgtaccagaggggaccatgaagccacagcca
agccctggggcccagtcgtcttgcagcagtgaccactccccagcaggcagtgcagctaat
acagacagtggtgtggaaatgactggaaatacagggggcagcactgaggacctatccaac
ttggacgagggaccttgcattgctggcactggtctgtccactcttcgccgccttgagaac
ctcaggctggaccaactccatcaactccggccaatagggccccggggcctcaaactgccc
agcttgacccacaccggcacccctgtgtcccgtcgtttgggccctccagttactcttgat
cgtcgcagcagcagctccagcagcgtcagctcagcctatactgtcagtcgccgctcctct
ctgacctcccctttcccccctagttctccaccagagaatggggcatcctcgctgcctggc
ctcacacctgcccagcactacctgctccgggcaagatatgcttcaaccaggggaggtggt
accccacccactgcagcaccttcttggagaagccgagctgagtatccaggatacaacccc
aatgtaggggtcacccggagagccagtgacccagcccgggctgctgaccgcccagcccca
gccagagtccaacggttcaagagcttgggttgtgtccacagcccccctacggtggcagga
ggaggacggagctttgatcccccactcccaacctctgtctactcaccacagccccctagt
atcactgagaatgtcaccatggataccagagggctacgggaggagccagaggttgggacc
tccatgatgggcagtggtctgaacccctatatggacttcccacctgctgatactctgggt
tatgggggacctgaaggggcagcaactgagccttatggagctaggggtccaggctccctg
cctcttggacctggtccacccaccaactacagccacaacgcttgttctcagcaggtctcc
tatcctgatcccactccagaaacatggggtgaactcccttcccactctgggctataccca
ggccctaagtctccagctggaacctacagccagtgtcctcgtctagaacattatggacac
atacaggtcaagccggaacagggatgtccgatgggttccgactccacaggactgggaccc
tgcctcaacgctcaccccaatgagggacctccacgtccacagactctgttctctcactac
ccccagccttcccctccccagtattcccagtcaggcccctatactcagccaacccctgat
tatcttccttcagaatctaggcctggcccagattttgattctcctactcattccacagga
cagctcaagactcagcttgtgtgtaattatgttcagtctcaacaggagctgctctgggag
ggtggaggtaggggagatcccccagtccaggaaccattctaccagagtcccaagtttctg
gggggctcccaggttaacccaagctctgccaaggtcccagtggccacctatggatctggc
tttgcacctaacttgcccagtcataagtcaggctcctatcccactccttcgacatgccat
gataattttgcaatggggacaaccaaggcttcccatagggcagcagcgccacctcgactt
ctgcctccactgcccacttgctatgggcccctcaaggcagggggcaccaaccccagctgt
ggccaccctgaggtgggcaggttgggagggggtcctaacttgtaccctcctcctgaaggg
caggtatgtaaccccttggactctcttgatcttgacaacactcagctggactttgtggct
attctggatgaggcccaggggctgagtccacccccttcccatgatcagggggacagctct
gaacataccccacctccctctggacctcccaacatggctgtgggcaacatgagtgtctta
ttgggatccctacctggggagacacaattcctcaactctagtgcctaa

DBGET integrated database retrieval system