KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501504
Entry
107501504         CDS       T06036                                 

Gene name
CDK4
Definition
(RefSeq) cyclin-dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04110  Cell cycle
ray04115  p53 signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04218  Cellular senescence
ray04530  Tight junction
ray04660  T cell receptor signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04934  Cushing syndrome
ray05160  Hepatitis C
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05212  Pancreatic cancer
ray05214  Glioma
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107501504 (CDK4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107501504 (CDK4)
   04115 p53 signaling pathway
    107501504 (CDK4)
   04218 Cellular senescence
    107501504 (CDK4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107501504 (CDK4)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107501504 (CDK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107501504 (CDK4)
   05203 Viral carcinogenesis
    107501504 (CDK4)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107501504 (CDK4)
   05225 Hepatocellular carcinoma
    107501504 (CDK4)
   05214 Glioma
    107501504 (CDK4)
   05220 Chronic myeloid leukemia
    107501504 (CDK4)
   05218 Melanoma
    107501504 (CDK4)
   05219 Bladder cancer
    107501504 (CDK4)
   05224 Breast cancer
    107501504 (CDK4)
   05222 Small cell lung cancer
    107501504 (CDK4)
   05223 Non-small cell lung cancer
    107501504 (CDK4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107501504 (CDK4)
   04934 Cushing syndrome
    107501504 (CDK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107501504 (CDK4)
   05160 Hepatitis C
    107501504 (CDK4)
   05164 Influenza A
    107501504 (CDK4)
   05162 Measles
    107501504 (CDK4)
   05163 Human cytomegalovirus infection
    107501504 (CDK4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107501504 (CDK4)
   05169 Epstein-Barr virus infection
    107501504 (CDK4)
   05165 Human papillomavirus infection
    107501504 (CDK4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107501504 (CDK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107501504 (CDK4)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     107501504 (CDK4)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  CDK family
   107501504 (CDK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like FTA2
Other DBs
NCBI-GeneID: 107501504
NCBI-ProteinID: XP_015983206
LinkDB
Position
Unknown
AA seq 302 aa
MATLRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAGGGLPISTVREVALLR
RLEAFEHPNVVRLMDVCATARTDRETKVTLVFEHVDQDLRTYLDKAPPPGLPVETIKDLM
RQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYR
APEVLLQSTYATPVDLWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRD
VSLPRGAFSPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKAEGN
PE
NT seq 909 nt   +upstreamnt  +downstreamnt
atggctacccttcgatatgagccggtggccgagattggtgttggtgcctatggaacggtg
tacaaggcccgtgatccccacagtggccactttgtcgccctcaagagcgtgagagttccc
aatggaggtgctggagggggcctgcccatcagcacagttcgtgaggttgctttactgagg
cgactggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccacagcc
cgaactgaccgggaaaccaaagtgaccctggtgtttgagcatgtggaccaagacctaagg
acgtatctggataaggcacccccaccaggcttgccagtggagaccatcaaggatctgatg
cgccagtttctaagaggcctagatttccttcatgccaactgcattgttcaccgggacctg
aagccagagaatattctggtgacaagtggtggaacagtcaagctggctgactttggcctg
gccagaatctacagctaccagatggcacttacacctgtggtcgttacactctggtaccgt
gctccggaagttcttctgcagtctacgtatgcaacacccgtggacttgtggagtgttggc
tgtatcttcgctgagatgttccgtcgaaagcctctcttttgcggaaattctgaagctgac
cagttaggcaaaatctttgacttgattgggctgcccccagaggatgactggccccgagat
gtctctctaccccggggagccttttcccccagagggccccgcccagtgcagtcggtggta
cctgagatggaggagtctggagcacagctgctgctggagatgctgacttttaacccacac
aagcgaatctctgccttccgagccctgcagcattcttatctacaaaaggcagaaggtaac
ccagagtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519055
Entry
107519055         CDS       T06036                                 

Gene name
CDK6
Definition
(RefSeq) cyclin-dependent kinase 6
  KO
K02091  cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04115  p53 signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04218  Cellular senescence
ray04934  Cushing syndrome
ray05160  Hepatitis C
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05206  MicroRNAs in cancer
ray05212  Pancreatic cancer
ray05214  Glioma
ray05218  Melanoma
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107519055 (CDK6)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107519055 (CDK6)
   04115 p53 signaling pathway
    107519055 (CDK6)
   04218 Cellular senescence
    107519055 (CDK6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519055 (CDK6)
   05206 MicroRNAs in cancer
    107519055 (CDK6)
   05203 Viral carcinogenesis
    107519055 (CDK6)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107519055 (CDK6)
   05225 Hepatocellular carcinoma
    107519055 (CDK6)
   05214 Glioma
    107519055 (CDK6)
   05220 Chronic myeloid leukemia
    107519055 (CDK6)
   05218 Melanoma
    107519055 (CDK6)
   05224 Breast cancer
    107519055 (CDK6)
   05222 Small cell lung cancer
    107519055 (CDK6)
   05223 Non-small cell lung cancer
    107519055 (CDK6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107519055 (CDK6)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107519055 (CDK6)
   05164 Influenza A
    107519055 (CDK6)
   05162 Measles
    107519055 (CDK6)
   05163 Human cytomegalovirus infection
    107519055 (CDK6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107519055 (CDK6)
   05169 Epstein-Barr virus infection
    107519055 (CDK6)
   05165 Human papillomavirus infection
    107519055 (CDK6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107519055 (CDK6)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     107519055 (CDK6)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  CDK family
   107519055 (CDK6)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like RIO1 FTA2 Seadorna_VP7
Other DBs
NCBI-GeneID: 107519055
NCBI-ProteinID: XP_016016773
LinkDB
Position
Unknown
AA seq 326 aa
MEKDSLSRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSNGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKTPQPIEKFVADIDEQGKDLLLKCLTFNPAKRISAYSALSHPYF
HDLERCKENLDSHLPPSQNSSEMNTA
NT seq 981 nt   +upstreamnt  +downstreamnt
atggagaaggacagcctgagccgcgcggaccagcagtacgagtgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgggacctgaagaacggaggccgtttcgtg
gcgctgaagcgtgtgcgggtgcagacgggcgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagacttttgagcaccccaacgtggtcaggttattc
gatgtgtgcacagtgtcacgaacagacagagaaaccaagctaacattagtgtttgaacat
gttgatcaagacttgaccacttatttggataaagtcccagagcctggagtgcccactgaa
accataaaggacatgatgtttcagcttctccgaggtctggactttcttcattctcaccga
gtcgtgcatcgcgatctaaaaccacagaacattctcgtgactagcaatggacaaataaaa
ctggctgacttcggccttgcccgcatctacagttttcagatggctctgacctcagtggtc
gtcacgctgtggtaccgagctccggaagtcttgcttcagtccagctacgccacccctgtg
gacctctggagcgttggctgcatatttgcagaaatgtttcgtagaaagcctcttttccgt
ggcagttcagatgtcgatcaactaggaaaaatcttggatgtaatcggactcccaggagag
gaggactggcctagagatgttgctcttcccaggcaggcttttcactcaaaaactcctcaa
cctattgagaagtttgtagcagatattgatgaacaaggcaaagacctgcttctgaagtgc
ttgacatttaatccagccaaaagaatatccgcctacagtgctctgtctcacccatacttc
catgacctggagaggtgcaaggagaacctggattcccacctgccacccagccagaacagc
tcggagatgaatacagcctga

DBGET integrated database retrieval system