KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501614
Entry
107501614         CDS       T06036                                 

Gene name
CHRM1
Definition
(RefSeq) muscarinic acetylcholine receptor M1
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04725  Cholinergic synapse
ray04810  Regulation of actin cytoskeleton
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107501614 (CHRM1)
   04024 cAMP signaling pathway
    107501614 (CHRM1)
   04151 PI3K-Akt signaling pathway
    107501614 (CHRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107501614 (CHRM1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107501614 (CHRM1)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107501614 (CHRM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107501614 (CHRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    107501614 (CHRM1)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    107501614 (CHRM1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srbc 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107501614
NCBI-ProteinID: XP_015983421
LinkDB
Position
Unknown
AA seq 460 aa
MNTSAPPAISPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCTLYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPESPSGRCCPCCRAPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPAKQPPRSSPNTVKRPTRKGRERAGKGQKPRGKEQLSKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgaatacctcggccccgcctgccatcagccccaacatcaccgtcctggcaccaggaaag
gggccctggcaagtggccttcattggaatcaccacaggcctcctgtcactggccactgtg
acaggcaacttgctggtactgatctccttcaaggtcaacacagagctcaagacggtcaac
aactacttcctgctcagcctggcctgcgccgacctcatcatcggcactttctccatgaac
ctctacaccacgtacctgctcatgggccactgggctctgggcacgctggcctgcgacctc
tggctggccctggactacgtggccagtaacgcctccgtcatgaacctgctgctcatcagc
tttgaccgctacttctccgtgacccggcccctgagctaccgggctaagcgcaccccgcgc
cgggcagctctgatgataggccttgcctggctggtgtcctttgtcctctgggccccagcc
atcctgttctggcagtatctggtgggggagcggacagtcctggccggacagtgctacatc
cagttcctctcccagcccatcatcacctttggcacggccatggccgccttctacctccct
gtcacggtcatgtgcacactctactggcgcatctaccgggaaacggagaaccgggcccgg
gagctggcagccctgcagggctccgagaccccaggtaaggggggcggcagcagcagcagc
tcagagagatcccagccaggggcggagggctcacccgagagcccctcagggcgttgctgt
ccctgctgccgggcccccaggctcctgcaggcctacagctggaaagaggaagaggaggag
gacgaaggctccatggagtccctcacgtcctcagagggtgaggagcctggctccgaggtg
gtgatcaagatgcccatggtggaccccgaggcacaggccccggccaagcagcccccccgg
agctccccgaatacagtcaagaggccgaccaggaaggggcgcgagcgggcgggcaagggc
cagaagccccgtgggaaggagcagctgtccaagcggaagaccttctcgctggtcaaggag
aagaaggcggctcggaccctgagtgccatcctgctggccttcatcctcacctggacaccg
tacaacatcatggtgctggtgtccactttctgcaaggactgtgtccccgagaccctgtgg
gagctgggctactggctgtgctacgtcaacagcaccatcaaccccatgtgctacgcgctc
tgcaacaaagccttccgggacaccttccgcctgctgctgctctgccgctgggacaagcga
cgctggcgcaagatccccaagcgccctggctcggtgcaccgcaccccttcccgccagtgc
tga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502405
Entry
107502405         CDS       T06036                                 

Gene name
CHRM3
Definition
(RefSeq) muscarinic acetylcholine receptor M3
  KO
K04131  muscarinic acetylcholine receptor M3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04725  Cholinergic synapse
ray04742  Taste transduction
ray04810  Regulation of actin cytoskeleton
ray04911  Insulin secretion
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107502405 (CHRM3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107502405 (CHRM3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107502405 (CHRM3)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107502405 (CHRM3)
  09154 Digestive system
   04970 Salivary secretion
    107502405 (CHRM3)
   04971 Gastric acid secretion
    107502405 (CHRM3)
   04972 Pancreatic secretion
    107502405 (CHRM3)
  09156 Nervous system
   04725 Cholinergic synapse
    107502405 (CHRM3)
  09157 Sensory system
   04742 Taste transduction
    107502405 (CHRM3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107502405 (CHRM3)
   05022 Pathways of neurodegeneration - multiple diseases
    107502405 (CHRM3)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    107502405 (CHRM3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107502405
NCBI-ProteinID: XP_015985057
LinkDB
Position
Unknown
AA seq 590 aa
MTLHNNDTRSPFFLNISNSWTRGSSDAGLPPGIVTHFVSYNISRTAGDFSSPNDTASDPL
GGHTLWQVVFIAFLTGILALVTIIGNVLVIVAFKVNKQLKTVNNYFLLSLACADLIIGVI
SMNLFTTYIIMNRWALGNLACDLWLSIDYVASNASVMNLLVISFDRYFSITRPLTYRAKR
TTKRAGVMIGLAWVISFVLWAPAILFWQYFVGKRTVPQGECFIQFLSEPTITFGTAIAAF
YMPVTIMTILYWRIYKETEKRTKELAGLQASGTEAEAENFVHPTGSSRSCSSYELQQQSL
KHSARRKYGRCHFWFTARHWKPSTEQVDQDQSSSDSWNNNDAAASLENSASSDEEDMGSE
TRAIYSIVLKLPGHSTILNSTKLPSSDNLQVPSEELGTMDLERQASKLQAQESMDDGGSF
QKSFSKLPIQLESAVDTAKASDVTSSVGKTMATLPLSFKEATLAKRFALKTRSQITKRKR
MSLIKEKKAAQTLSAILLAFIITWTPYNIMVLVNTFCDSCIPKTYWNLGYWLCYINSTVN
PVCYALCNKTFRTTFKMLLLCQCDKRKRRKQQYQQRQSVIFHKRVPEQAL
NT seq 1773 nt   +upstreamnt  +downstreamnt
atgaccttgcacaacaacgacacacgctcgcctttcttcctgaacatcagcaattcctgg
acgcgtggctcctcagacgcagggctgcccccgggaatcgtcactcattttgtcagctac
aacatttctcgaacagctggggatttctcttctccaaacgacaccgccagtgatcctctg
ggagggcataccctctggcaagtggtctttattgcgttcttaaccggcatcctggccctg
gtgaccatcatcggcaacgtcctagtgatagtggcatttaaggtcaacaagcaactgaag
acagtcaataactacttcctcctcagcctggcctgtgcagatctgattattggggtcatt
tcaatgaatctgttcaccacgtacattattatgaaccgatgggccttgggaaacttggcc
tgtgacctctggctttccattgactatgtggctagcaatgcctcagtcatgaatctcctg
gtaattagctttgacaggtacttttccatcacaaggccactcacataccgggccaaacga
acaacaaaaagagccggcgtgatgataggcctggcttgggtcatctcctttgtcctttgg
gctcctgccatcttgttctggcagtactttgttgggaagagaactgtgccccaaggggag
tgtttcatccagttcctcagcgagcccaccatcaccttcggcacggccatcgccgccttt
tatatgcctgtcaccattatgactattttatactggaggatctataaggaaactgagaaa
cgtaccaaagagcttgctgggctacaagcctctgggacggaagcagaggcagaaaacttt
gtccaccccacgggcagttctcgaagctgcagcagctatgagcttcaacagcaaagcttg
aaacactctgcccggagaaagtatggccgctgccacttctggttcacggccaggcactgg
aagcccagtaccgagcaggtggaccaggaccaaagcagcagcgacagctggaataacaac
gacgctgctgcctccctggaaaactccgcgtcctctgacgaggaggacatgggctcggag
acgagagccatctactccatcgtgctcaagctcccgggccacagcaccatcctcaactcc
accaagttaccctcatcggacaacctgcaggtgcccagcgaggagctcgggacgatggac
ttagagaggcaagccagtaagctgcaggcccaggagagcatggacgacggaggcagcttt
caaaaaagcttttccaagcttcccatccagttagagtcagcagtggacacagccaaagcc
tctgatgtcacctcctcagtgggtaagaccatggccactctacctctgtcctttaaggaa
gccactctggccaaaaggtttgctctgaagaccagaagtcagatcactaagcggaagcgg
atgtcgctcatcaaggagaagaaggcagcccagaccctcagtgccatcctgctcgccttc
atcatcacctggaccccctacaacatcatggtcctggtgaacaccttctgtgacagctgt
atacccaaaacctattggaatctgggctactggctgtgctacatcaacagcaccgtgaac
cccgtgtgctatgccctgtgcaacaaaacattcagaaccactttcaagatgctgctactg
tgccagtgtgacaaaaggaagagacgcaagcagcagtaccagcaaagacagtcggtgatt
tttcacaagcgtgtgcccgagcaggccttgtag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518787
Entry
107518787         CDS       T06036                                 

Gene name
CHRM5
Definition
(RefSeq) muscarinic acetylcholine receptor M5
  KO
K04133  muscarinic acetylcholine receptor M5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04725  Cholinergic synapse
ray04810  Regulation of actin cytoskeleton
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107518787 (CHRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107518787 (CHRM5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107518787 (CHRM5)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    107518787 (CHRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107518787 (CHRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    107518787 (CHRM5)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    107518787 (CHRM5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srbc 7tm_4
Other DBs
NCBI-GeneID: 107518787
NCBI-ProteinID: XP_016016284
LinkDB
Position
Unknown
AA seq 532 aa
MEGGSYHNATIVNGTPVNHQPLERHRLWEVVTIAAVTAVVSLITIVGNILVMISFKVNSQ
LKTVNNYYLLSLACADLIIGIFSMNLYTTYILMGRWALGSLACDLWLALDYVASNASVMN
LLVISFDRYFSITRPLTYRAKRTPKRAGIMIGLAWLISFILWAPAILCWQYLVGERTVPP
DACQIQFLSEPTITFGTAIAAFYIPVSVMTILYCRIYRETEKRTKDLADLQGSDSMAETA
KRKPAHKALLRSCFSCPWSTLAHRERNQASWSSSRRSTSTTGKPSQATGPSTEWDKAEQL
TTCSSYPSSEDEDKPTTDPVFQVVYKSQAKESPREEFSTEETKETFVKSQTEKNDYDSPK
YFLSPAAAHRPRSQKCVAYKFRLVVKADGTQETNNGCRKVKIMPCSSPVSKDPSTKGLNP
NLSHQMTKRKRMVLVKERKAAQTLSAILLAFIITWTPYNIMVLVSTFCDKCVPVSLWHLG
YWLCYVNSTINPICYALCNRTFRKTFKMLLLCRWKKKKVEEKLYWQGNSKLP
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggaaggaggatcttaccacaacgcaactattgtcaatggcaccccagtaaatcatcag
cctttggaacgccacaggttgtgggaagtcgtcacaatcgcagctgtgactgctgtggta
agcctaatcaccattgtgggcaacatcttagtcatgatctccttcaaagtcaatagtcag
ttgaagacagttaacaactattatctgctcagcttggcctgtgcagatctcatcattggg
atcttctccatgaacctctacactacttatatcctcatgggacgctgggctctcgggagt
ctggcttgtgacctttggcttgcactggactacgtggccagcaatgcttccgtcatgaac
cttctggtgatcagttttgaccgttacttttccatcacaagacccctgacgtatcgggcc
aagcgtaccccaaagagagctggcatcatgattggcttggcctggctgatctccttcatc
ctctgggccccagcgatcctctgctggcagtacttagttggagagcgaacagtaccacca
gatgcatgccagatccagttcctctctgagcccaccatcacttttggcactgccattgct
gccttctacattcctgtttctgtcatgacgattctctactgccgaatctatcgggaaaca
gagaagcggaccaaggaccttgctgacctccagggctctgactccatggctgaaactgcg
aaaagaaagccagctcataaggctctgctcaggtcctgttttagctgcccttggtccaca
ctggcccacagggaaaggaaccaagcttcctggtcatcctcccgcaggagcacctccacc
actgggaagccatcccaagccaccggcccaagcactgaatgggacaaagctgagcagctc
actacctgtagcagctacccctcctcagaggatgaggacaaacccaccactgaccctgtc
ttccaagtggtctacaagagtcaggccaaggaaagcccaagggaagagtttagtactgaa
gagaccaaggaaacttttgtgaaaagtcaaactgaaaaaaatgactatgactcaccaaaa
tacttcttgtctccagctgctgctcacagacccaggagtcagaaatgtgtggcctataag
ttccgactggtggtcaaagctgatgggacccaggagaccaacaatggttgtcgcaaggtg
aaaatcatgccctgctcgtccccggtgtccaaggacccttcgacaaaaggcctcaatcca
aaccttagccatcaaatgaccaaacgaaagagaatggtccttgtcaaagagagaaaagca
gcccagaccttgagcgccattctcctggccttcatcatcacatggaccccttataacatc
atggtccttgtttccaccttctgcgacaagtgtgtcccagtctccctgtggcacttaggc
tactggctgtgctatgtcaatagcactatcaaccccatttgctatgccctctgcaacaga
accttcaggaagacctttaaaatgctgcttctctgccgatggaaaaagaaaaaagtggaa
gagaagttgtactggcaggggaacagcaagctcccctga

DBGET integrated database retrieval system