KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501740
Entry
107501740         CDS       T06036                                 

Gene name
CGA
Definition
(RefSeq) glycoprotein hormones alpha chain
  KO
K08522  glycoprotein hormones alpha chain
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
ray04917  Prolactin signaling pathway
ray04918  Thyroid hormone synthesis
ray04923  Regulation of lipolysis in adipocytes
ray04929  GnRH secretion
ray05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107501740 (CGA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107501740 (CGA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    107501740 (CGA)
   04929 GnRH secretion
    107501740 (CGA)
   04912 GnRH signaling pathway
    107501740 (CGA)
   04913 Ovarian steroidogenesis
    107501740 (CGA)
   04917 Prolactin signaling pathway
    107501740 (CGA)
   04918 Thyroid hormone synthesis
    107501740 (CGA)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107501740 (CGA)
SSDB
Motif
Pfam: Hormone_6 Styelin
Other DBs
NCBI-GeneID: 107501740
NCBI-ProteinID: XP_015983680
LinkDB
Position
Unknown
AA seq 120 aa
MDYYRKHAAVILATLSVFLHILHSFPDGEFIMQGCPECKLKENKYFSKLGAPIYQCMGCC
FSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNTKVENHTECHCSTCYYHKS
NT seq 363 nt   +upstreamnt  +downstreamnt
atggattactacagaaaacatgcagctgtcattctggccacattgtctgtgtttctgcat
attcttcattcctttcctgatggagagtttataatgcagggttgcccagaatgcaagcta
aaggaaaacaaatacttttccaagctgggtgctccaatttatcaatgtatgggctgctgc
ttctccagagcatatcccactccagctagatccaagaagacaatgttggtcccaaagaat
atcacctcagaagcgacatgctgcgtggccaaagcatttaccaaggccacagtaatggga
aacaccaaagtggaaaaccacacagagtgccactgcagtacttgttattatcacaaatct
taa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515744
Entry
107515744         CDS       T06036                                 

Gene name
FSHB
Definition
(RefSeq) follitropin subunit beta
  KO
K05250  follitropin subunit beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04912  GnRH signaling pathway
ray04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107515744 (FSHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107515744 (FSHB)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107515744 (FSHB)
   04913 Ovarian steroidogenesis
    107515744 (FSHB)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 107515744
NCBI-ProteinID: XP_016010342
LinkDB
Position
Unknown
AA seq 129 aa
MKSVQLCFLFCFWKAICCNSCELTNITITVEREECRFCISINTTWCAGFCYTRDLVYKDP
ARPNIQKTCTFKELVYETVKVPGCAHHANSLYAYPVATECHCGKCDSDNTDCTVRGLGPS
YCSFSEMKE
NT seq 390 nt   +upstreamnt  +downstreamnt
atgaagtcagtccagttgtgcttccttttctgtttctggaaagcaatctgctgcaacagc
tgtgagctgaccaacatcaccatcacagtggagagagaggaatgtcgcttctgcatcagc
atcaacaccacttggtgtgcaggcttctgctacacccgggatctggtgtacaaggaccca
gccaggcccaatatccagaaaacatgtaccttcaaggagctggtgtatgagactgtcaaa
gtgcctggctgcgctcaccatgcaaattccctgtatgcatacccagtggccactgaatgt
cactgtggcaagtgcgatagcgacaacactgactgcacagtgcgaggcctgggtcccagc
tactgctccttcagtgaaatgaaagaataa

DBGET integrated database retrieval system