KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501830
Entry
107501830         CDS       T06036                                 

Gene name
CASP9
Definition
(RefSeq) caspase-9
  KO
K04399  caspase 9 [EC:3.4.22.62]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01524  Platinum drug resistance
ray04115  p53 signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04215  Apoptosis - multiple species
ray04370  VEGF signaling pathway
ray04919  Thyroid hormone signaling pathway
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05134  Legionellosis
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05215  Prostate cancer
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    107501830 (CASP9)
   04151 PI3K-Akt signaling pathway
    107501830 (CASP9)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107501830 (CASP9)
   04215 Apoptosis - multiple species
    107501830 (CASP9)
   04115 p53 signaling pathway
    107501830 (CASP9)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    107501830 (CASP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107501830 (CASP9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107501830 (CASP9)
   05212 Pancreatic cancer
    107501830 (CASP9)
   05215 Prostate cancer
    107501830 (CASP9)
   05213 Endometrial cancer
    107501830 (CASP9)
   05222 Small cell lung cancer
    107501830 (CASP9)
   05223 Non-small cell lung cancer
    107501830 (CASP9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107501830 (CASP9)
   05012 Parkinson disease
    107501830 (CASP9)
   05014 Amyotrophic lateral sclerosis
    107501830 (CASP9)
   05016 Huntington disease
    107501830 (CASP9)
   05020 Prion disease
    107501830 (CASP9)
   05022 Pathways of neurodegeneration - multiple diseases
    107501830 (CASP9)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107501830 (CASP9)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    107501830 (CASP9)
   05152 Tuberculosis
    107501830 (CASP9)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107501830 (CASP9)
   05161 Hepatitis B
    107501830 (CASP9)
   05160 Hepatitis C
    107501830 (CASP9)
   05164 Influenza A
    107501830 (CASP9)
   05162 Measles
    107501830 (CASP9)
   05168 Herpes simplex virus 1 infection
    107501830 (CASP9)
   05163 Human cytomegalovirus infection
    107501830 (CASP9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107501830 (CASP9)
   05169 Epstein-Barr virus infection
    107501830 (CASP9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107501830 (CASP9)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107501830 (CASP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107501830 (CASP9)
   01002 Peptidases and inhibitors [BR:ray01002]
    107501830 (CASP9)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.62  caspase-9
     107501830 (CASP9)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107501830 (CASP9)
Peptidases and inhibitors [BR:ray01002]
 Cysteine peptidases
  Family C14: caspase family
   107501830 (CASP9)
SSDB
Motif
Pfam: Peptidase_C14 CARD CARD_2
Other DBs
NCBI-GeneID: 107501830
NCBI-ProteinID: XP_015983871
LinkDB
Position
Unknown
AA seq 435 aa
MDEADRQLLRRCRVQLVRELQVASLWDALLNYELFTPDMIEDIQRAGSGSRRDQARQLIT
DLETRGSQALPLFISCLEDTGQNSLASLLRTSSQTAKRNPEAIRPLDFMPVVVRPVSVKP
EELTHVVKQDPSKLTPGPEGLRPEAPRPVDIGSGGRSDIRAQEGLRGNADLVYVLNADPC
GHCLIINNVHFYPESRLSARPGSNVDCEKLQRRFRLLHFMVEVKCDLTCKQIVQALVELA
QRDHSALDCCVVVILSHGCQASHLQFPGAVYGTDGFPVPIEKIVNIFNGTGCPSLGGKPK
LFFIQACGGEQKDCGFAVVSASPEDRAPGSDPEPDAVPFRDRSGSCDQPDAVSSLPTPSD
IFVSYSTFPGFVSWRDPRSGSWYIETLDSIFEQWAHSEDLHSLLLRVANAVSQKGIYKQI
PGCFNFLRKKLFFKT
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggacgaggctgaccggcaacttctgcggcgatgccgggtgcagctggttcgcgaattg
caggtggcatctctctgggacgctctcctgaactacgagctcttcacgcccgacatgatc
gaggacatccagcgagcgggctctgggtctcgccgggatcaggccaggcagctgatcaca
gatctggagactcgagggagtcaggcccttcctttgttcatctcctgcttagaggacaca
ggccagaacagcctggcttcattgctgagaacgagcagccaaacagcaaagcgaaatccg
gaggccattagacccctggacttcatgcctgtggtggttagaccagtgagcgtcaaacca
gaggagctgactcacgtggtgaagcaagatccatcgaaactgaccccggggccagagggt
ctcagaccggaggcgcccagaccagtggacatcggttccggaggacgcagtgatatccgc
gctcaggagggactgaggggaaacgccgatttggtgtacgtcctgaacgcagacccctgt
ggccactgcctcattatcaacaacgtgcacttctaccccgagtcgcggctcagcgcccgc
cccggctccaacgtcgactgtgagaagctgcagcgacgcttccgcttgttgcatttcatg
gtggaggtgaagtgcgacctgacttgcaagcaaatagtccaggctttggtggagctggca
cagcgggaccacagcgcactggactgctgtgtggtggtcatcctctctcatggctgccag
gccagccacctccagttcccgggggctgtttatggcacagacgggtttcctgtgcccatc
gagaaaattgtgaacatcttcaacggaactggctgccccagcttgggagggaagcccaag
ctctttttcatccaggcctgtggtggagagcagaaagactgtgggtttgcagtggtctcc
gcctcccctgaggacagggcccctggcagcgaccctgagccagacgctgtgccgttccgg
gaccgttcaggcagctgcgaccagccggatgctgtgtctagtttgcccacacctagtgac
atctttgtgtcctactccaccttcccaggctttgtctcctggagggaccccagaagtggc
tcctggtacatcgagaccctggacagcatctttgagcagtgggctcactctgaggacctg
catagcctcctgctgagggtcgccaatgccgtctcccaaaaagggatttacaaacagatt
cctggctgtttcaactttctccggaagaaactcttttttaaaacttaa

DBGET integrated database retrieval system