KEGG   Rousettus aegyptiacus (Egyptian rousette): 107501966
Entry
107501966         CDS       T06036                                 

Gene name
PPP2R5D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04728  Dopaminergic synapse
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107501966 (PPP2R5D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107501966 (PPP2R5D)
   04151 PI3K-Akt signaling pathway
    107501966 (PPP2R5D)
   04152 AMPK signaling pathway
    107501966 (PPP2R5D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107501966 (PPP2R5D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107501966 (PPP2R5D)
  09156 Nervous system
   04728 Dopaminergic synapse
    107501966 (PPP2R5D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107501966 (PPP2R5D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107501966 (PPP2R5D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107501966 (PPP2R5D)
   03036 Chromosome and associated proteins [BR:ray03036]
    107501966 (PPP2R5D)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107501966 (PPP2R5D)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107501966 (PPP2R5D)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107501966 (PPP2R5D)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 107501966
NCBI-ProteinID: XP_015984121
LinkDB
Position
Unknown
AA seq 606 aa
MPYKLKKEKEPPKLAKGAAKPSSSGKDGGGENTEEAQPQPQPQPQPQPQPQPQSQPPSSN
KRPSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREE
LFIQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFS
VNLFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYID
QKFVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNG
IAELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESS
LTEPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHF
QVAERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEM
NQKLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMET
ETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLT
ASQEAL
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgccctataaactgaagaaggagaaggagccccctaagcttgccaaaggtgcagccaaa
cccagcagctcgggcaaggatggtggaggcgagaacactgaagaggcccagccacagcca
cagccacagccacaaccgcagccacagccacagccccagtctcagccaccatcatccaac
aagcgtcccagcaacagcacaccaccccccacgcagctcagcaaaatcaagtactcaggg
gggccccaaattgtcaagaaggagcggcggcaaagctcctcccgcttcaacctcagcaag
aaccgggagttgcagaagcttcctgctctgaaagattcgccaacccaggagcgggaggag
ctgtttatccagaagctgcgccagtgctgtgtcctttttgactttgtgtcagacccactc
agtgacctcaaattcaaggaggtgaagcgggcaggactcaatgaaatggtggagtatatc
acccatagccgcgatgttgtcaccgaggccatttaccccgaggctgtcaccatgttttca
gtgaatctcttccggacactgccaccttcatcaaatcctactggtgccgagtttgaccca
gaggaagatgagcccactctggaagctgcgtggccacatctccagctcgtgtacgagttt
ttcttacgtttccttgagtctcctgatttccagccaaacatagccaagaagtacattgac
cagaagtttgtccttgctctcctggacctgtttgacagtgaggatcctcgagagcgggac
ttcctcaagaccatcttgcatcgcatctatggcaagtttttggggctccgggcttatatc
cgtaggcagatcaaccacatcttctacaggttcatctatgagacggagcatcacaatggg
attgctgagctcctggagatcctgggcagcatcatcaatggctttgccttgccccttaag
gaagagcataagatgttccttatccgtgtcctgcttccccttcacaaggtcaagtccctg
agtgtctaccaccctcagctggcatactgtgtggtacaattcttggagaaggaaagcagt
ctcactgagccggtgattgtgggacttctcaagttctggcccaagacccacagccccaag
gaggtgatgttcctgaatgagctagaggagattctagatgtcattgaaccttcagagttc
agcaaagtgatggaaccactcttccgccagcttgccaaatgtgtctccagcccccatttc
caggtggcagagcgtgcgctctattactggaacaacgagtacatcatgagcctgataagt
gacaatgctgcccgagtcctccccataatgttccctgcactctacaggaactccaagagc
cactggaacaagacaatccatggactgatctacaatgctctgaagttatttatggagatg
aatcagaagctgtttgatgactgcacacaacaatacaaggcagagaagcagaagggcagg
ttccgaatgaaggaaagagaagagatgtggcaaaagattgaggagctggcccgacttaat
ccccagtatcccatgttccgagctccgccaccactgcctcctgtgtactcaatggagaca
gagacccccactgcagaggacattcagcttctgaagaggacagtggagacagaggctgtg
cagatgctgaaggacatcaagaaggagaaagtgctgcttcggaggaagtcagagctgccc
caggacgtgtacaccattaaggcactggaggcgcataagcgggcagaagagttcttaact
gccagccaggaggctctctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107509328
Entry
107509328         CDS       T06036                                 

Gene name
PPP2R5E
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04728  Dopaminergic synapse
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107509328 (PPP2R5E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107509328 (PPP2R5E)
   04151 PI3K-Akt signaling pathway
    107509328 (PPP2R5E)
   04152 AMPK signaling pathway
    107509328 (PPP2R5E)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107509328 (PPP2R5E)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107509328 (PPP2R5E)
  09156 Nervous system
   04728 Dopaminergic synapse
    107509328 (PPP2R5E)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107509328 (PPP2R5E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107509328 (PPP2R5E)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107509328 (PPP2R5E)
   03036 Chromosome and associated proteins [BR:ray03036]
    107509328 (PPP2R5E)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107509328 (PPP2R5E)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107509328 (PPP2R5E)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107509328 (PPP2R5E)
SSDB
Motif
Pfam: B56 SBF2 Sec7_N
Other DBs
NCBI-GeneID: 107509328
NCBI-ProteinID: XP_015997274
LinkDB
Position
Unknown
AA seq 467 aa
MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQP
ELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVS
CNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKF
VLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAE
LLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPSLTE
PVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCVSSPHFQVA
ERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNSA
MFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcctcagcaccaactactcctccatcagtggataaagtagacggattttctcggaag
tccgtcagaaaagccagacagaagaggtcgcaaagttcctcacagtttaggtctcaaggc
aagcctattgagttaacacctctgcctctcctgaaagacgttccatcctcagagcagcct
gaactgttcctaaagaaacttcagcagtgctgtgtcatttttgacttcatggacacgcta
tctgatcttaaaatgaaagaatacaagcgctccactcttaatgaactggtggactacatt
acaataagcagaggctgtttgacagagcagacttaccctgaagtagttagaatggtatct
tgcaatatattcagaactctccctcctagtgacagcaatgaatttgatccagaagaagat
gaacctaccctggaggcatcctggccacatttacagcttgtatatgaatttttcatacga
tttttggaaagccaagaattccaacccagcattgccaaaaaatacatagatcagaaattt
gtattacagcttttggagctatttgacagtgaagaccctcgggaacgagactacttaaaa
acagtcttacacagaatttatggcaagtttcttggtcttagagcatttatccgaaaacag
attaacaatatttttctaaggtttgtttatgaaacagaacacttcaatggtgtagctgaa
ctgctggaaatattaggaagtattatcaatggcttcgctttacctcttaaggcagaacac
aaacagtttctggtgaaagtgttgatccctttgcacactgtcaggagcttatcactcttc
catgcccagctggcgtattgcatagtacagtttctggagaaagacccttcactaacagaa
ccagttattagagggttaatgaaattttggcccaaaacatgtagtcaaaaagaggtcatg
ttccttggggagctggaagagatattggatgtgattgaaccttcacagtttgttaaaatt
caagaacctttgtttaaacaaattgccaagtgtgtatctagcccccattttcaggtggca
gaaagggcactctattattggaataatgaatacatcatgagtttgatagaagaaaactct
aatgtcatccttcccatcatgttttccagtctttataggatttcaaaagaacattggaac
ccggctatcgtggcattagtctacaatgtgttgaaggcatttatggagatgaacagcgcc
atgtttgatgagctgacagccacatacaagtcagatcgtcagcgtgagaaaaagaaagaa
aaggagcgtgaagaattatggaaaaaactggaggatctggagttgaagagaggtcttaga
cgtgatgggataattccaacctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517041
Entry
107517041         CDS       T06036                                 

Gene name
PPP2R5B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04728  Dopaminergic synapse
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107517041 (PPP2R5B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107517041 (PPP2R5B)
   04151 PI3K-Akt signaling pathway
    107517041 (PPP2R5B)
   04152 AMPK signaling pathway
    107517041 (PPP2R5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107517041 (PPP2R5B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107517041 (PPP2R5B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107517041 (PPP2R5B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107517041 (PPP2R5B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107517041 (PPP2R5B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107517041 (PPP2R5B)
   03036 Chromosome and associated proteins [BR:ray03036]
    107517041 (PPP2R5B)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107517041 (PPP2R5B)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107517041 (PPP2R5B)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107517041 (PPP2R5B)
SSDB
Motif
Pfam: B56 FTCD_C
Other DBs
NCBI-GeneID: 107517041
NCBI-ProteinID: XP_016012836
LinkDB
Position
Unknown
AA seq 509 aa
METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELT
PLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGV
LIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPD
FQPSVAKRYVDQKFVLMVKWGAEAGWYHGLLELFDSEDPREREYLKTILHRVYGKFLGLR
AYIRKQCSHIFLRFIYELEHFNGVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSV
KSLSVFHAQLAYCVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEP
SQFVKIQEPLFKQVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQV
SKEHWNQTIVSLIYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELR
LRRLQGTQGAKEAPLQRLTPPVAASGGQS
NT seq 1530 nt   +upstreamnt  +downstreamnt
atggagacgaagctgcccccggcaagcacccccaccagcccctcttctccagggctatcg
cctgtgcccccacccgacaaggtggatggtttctcccgccgttccctccgcagggcccgg
cccaggcgctcccatagttcctctcagttccgctatcagagcaaccagcaggagctcact
ccactgcccctgctcaaagatgtgccagcttctgagctgcatgagctgctgagcaggaag
ctggcccagtgcggggtgatgtttgacttcttggactgtgtggccgaccttaaggggaag
gaggtgaagcgggcagccctcaatgagctggtggagtgcgtggggagcacccgtggggtc
ctcattgagcccgtctacccagacatcatccgcatgatctcagtgaatatcttccggacc
ctgccacccagtgagaaccctgaatttgaccctgaagaggatgagcccaaccttgagcct
tcgtggccacatctgcagctggtatatgagtttttcctgcgtttcttggagagcccagac
ttccagccctccgtggccaagagatatgtggatcaaaagtttgtcctgatggtgaagtgg
ggagccgaggctgggtggtaccatgggcttctggagctgtttgatagtgaggacccccgg
gagcgtgagtacctcaagaccatcctgcaccgggtctatggcaagttcctggggctccgg
gcctatatccgcaaacagtgcagccacatctttctcaggttcatctatgaactcgagcac
ttcaatggcgtggctgagctactggagatcttagggagcatcatcaatggctttgcgctg
cccctgaagactgagcacaagcagttcctggtccgggtcctgattcccctgcactctgtc
aagtcactgtctgtctttcatgcccagctggcgtactgcgtggtgcagttcctggagaag
gatgccaccttgacagagcatgtcatccgggggctgctcaaatactggccaaaaacctgc
acccagaaggaggtgatgtttctgggggagatggaagagatccttgatgtcattgagccc
tcccagtttgtgaagatccaggagcccctctttaagcaggtggctcgctgtgtgtctagc
ccccatttccaggttgcagagcgggctctgtatttctggaacaatgagtatatcctgagc
ctcattgaggacaactgccacactgtgctgcctgctgtctttgggaccctctaccaagtc
tccaaggagcactggaatcaaaccatcgtatctctgatctataacgtgctcaagaccttc
atggagatgaatgggaagctgttcgatgagctcacagcctcctacaagctggaaaagcag
caggagcagcaaaaggcccaggaacgtcaggagctgtggcaaggcctggaggagctacgg
ctacgccggttacaggggacccagggagccaaagaggcccccctccagcgccttacaccc
ccggtggccgccagtgggggtcagagctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521366
Entry
107521366         CDS       T06036                                 

Gene name
PPP2R5C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04728  Dopaminergic synapse
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107521366 (PPP2R5C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107521366 (PPP2R5C)
   04151 PI3K-Akt signaling pathway
    107521366 (PPP2R5C)
   04152 AMPK signaling pathway
    107521366 (PPP2R5C)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107521366 (PPP2R5C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107521366 (PPP2R5C)
  09156 Nervous system
   04728 Dopaminergic synapse
    107521366 (PPP2R5C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107521366 (PPP2R5C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107521366 (PPP2R5C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107521366 (PPP2R5C)
   03036 Chromosome and associated proteins [BR:ray03036]
    107521366 (PPP2R5C)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107521366 (PPP2R5C)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107521366 (PPP2R5C)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107521366 (PPP2R5C)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 107521366
NCBI-ProteinID: XP_016021466
LinkDB
Position
Unknown
AA seq 578 aa
MPNKNKKEKDLPKAGKSGKSSKDGQDVLEPEIPSKKNSLITAPSTSSSKIKVPLSQPTVK
KEKRQNSSRFSITSNRELQKLSSLKDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWK
EVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPT
LEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTL
HRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIF
LLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPKEVMFLN
ELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKI
LPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKER
EEAWVKIENLAKANPQYAVYSQASTVSIPVAMETDGPLFEDVLMLRKTVNEEARQAQKDL
KKDRPLIRRKSELPQEPHTKNALEARCRADPLLPQDGR
NT seq 1737 nt   +upstreamnt  +downstreamnt
atgccgaataaaaacaagaaggagaaagatttacccaaagcagggaaaagtggaaaaagt
tccaaagacggacaagacgtattagaacccgagattcccagcaagaaaaacagccttatt
actgccccgtccacatcatccagtaaaataaaagtgccactctctcagcccacggtgaag
aaagaaaaacggcagaattcctccagatttagcatcaccagtaacagagagcttcaaaaa
ctgtcgtctttgaaagatgttcctcctgccgatcaagagaagctcttcatccagaagtta
cgtcagtgttgtgtcctctttgactttgtttccgacccactcagcgacctaaagtggaag
gaagtgaagcgagctgctttgagtgagatggtagagtacatcacccataatcggaacgtg
atcacagagccgatctacccggaagtagtgcacatgtttgcagttaacatgttccgaacg
ttaccgccttcctccaaccctacgggagcagagttcgacccagaggaagacgagccaacg
ttagaagccgcctggcctcacctgcagcttgtttatgaatttttcttaagatttttagag
tctccagatttccaacctaatatagcgaagaaatatatcgaccagaaatttgtattgcag
cttttagagctctttgacagcgaagatccccgagagagagattttcttaaaacgaccctt
cacagaatctatgggaaattcttaggcttaagagcttacatcagaaaacagataaataat
atattttataggtttatttatgaaacagagcatcacaatggcatagcagagttactggag
atactgggaagcataatcaacgggtttgccttaccgctgaaagaagagcacaagatcttc
ttactgaaggtgttgctgcctctgcacaaagtgaagtccctgagcgtctaccacccccag
ctggcatactgtgtagtccagtttctagaaaaggacagcaccctcaccgaaccggtggtg
atggcacttctcaaatactggccaaagactcacagtccaaaggaagtgatgttcctgaac
gagctggaggagatcctggacgtgatcgagccgtcggagttcgtcaagatcatggagccg
ctcttccggcagctggccaagtgtgtctccagcccccacttccaggtggcggagcgggcc
ctgtactactggaacaacgagtacatcatgagcctgatcagcgacaacgcggccaagatc
ctgcccatcatgttcccgtccttgtaccgcaactcgaagacccactggaacaagacaatc
catggcttgatatacaacgcgctgaaactgttcatggagatgaaccagaagctgtttgac
gactgcacccagcagttcaaagcggagaagctgaaagagaagctaaaaatgaaagaacgt
gaagaagcgtgggttaaaatagagaatctagccaaagcaaacccccagtacgcagtgtat
agtcaagcgagcaccgtgagcatcccggttgcaatggagacagatgggcccttgtttgaa
gatgtgctgatgctgagaaagacagtgaacgaagaggctcgccaggcacagaaggacctg
aagaaggaccggcccctgatccgccgcaagtccgagctgcctcaggagccccacaccaag
aacgccttggaggctcgctgcagagccgacccgctgctgccccaggacggccgctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521621
Entry
107521621         CDS       T06036                                 

Gene name
PPP2R5A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03015  mRNA surveillance pathway
ray04071  Sphingolipid signaling pathway
ray04114  Oocyte meiosis
ray04151  PI3K-Akt signaling pathway
ray04152  AMPK signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04728  Dopaminergic synapse
ray05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    107521621 (PPP2R5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    107521621 (PPP2R5A)
   04151 PI3K-Akt signaling pathway
    107521621 (PPP2R5A)
   04152 AMPK signaling pathway
    107521621 (PPP2R5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107521621 (PPP2R5A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107521621 (PPP2R5A)
  09156 Nervous system
   04728 Dopaminergic synapse
    107521621 (PPP2R5A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    107521621 (PPP2R5A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107521621 (PPP2R5A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ray03019]
    107521621 (PPP2R5A)
   03036 Chromosome and associated proteins [BR:ray03036]
    107521621 (PPP2R5A)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     107521621 (PPP2R5A)
Messenger RNA biogenesis [BR:ray03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     107521621 (PPP2R5A)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     107521621 (PPP2R5A)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 107521621
NCBI-ProteinID: XP_016021947
LinkDB
Position
Unknown
AA seq 485 aa
MSSSSPPGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLKD
ATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAYS
DIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIAK
RYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYETE
HFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFLE
KDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKSVS
SSHFQVAERALYFWNNEYILSLIEENIDKILPIMFGSLYKISKEHWNQTIVALVYNVLKT
LMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSILS
NTSNE
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcgtcgccgccgggggctgccagcgccgccatctcggcctcggagaaagtg
gacggcttcacccggaaatcggtgcgcaaggcgcagaggcagaagcgctcccagggctcg
tcgcagttccgcagccagggcagccaggcggagctgcaccccttgccccagctcaaagat
gccacttcaaatgaacaacaagagctcttctgtcagaagttgcagcagtgttgtatactg
tttgatttcatggactctgtttcagacttgaagagcaaagaaattaaaagagcaacactg
aacgaactggttgagtatgtttcaactaatcgtggtgtaattgtcgaatcagcgtattct
gatatagtaaaaatgataagtgctaacatcttccgtactcttcctccaagcgataatcca
gattttgatccggaagaagatgaacccacacttgaggcttcttggcctcacatacaattg
gtgtatgaattcttcttaagatttttggagagccctgatttccagcctagcattgcaaaa
cgatacattgatcagaaatttgtacaacagctcctggagctttttgatagtgaagatccc
agagaacgtgactttctgaagactgttcttcatcgaatttatgggaaatttcttggatta
agagcattcatcagaaaacaaattaacaacattttcctcaggtttatatatgaaacagaa
catttcaatggtgttgctgaactccttgaaatattaggaagtattatcaatggctttgca
ttgccactgaaagcagaacataaacaatttctaatgaaggttcttattcccatgcatact
gcaaaaggattagctttgtttcatgctcagctagcctactgtgttgtacagttcctggag
aaagatacaacgctaacggaaccagtgatcagaggattgctgaaattttggccaaaaacg
tgcagtcagaaagaggtgatgtttttaggagaaattgaagaaatcttagatgtcatcgaa
ccaacacagttcaaaaaaattgaagagcccctttttaagcagatatccaagagtgtatcc
agttctcattttcaggttgcagaaagggcattgtacttctggaataatgaatatattctt
agtttgattgaggagaatatcgataaaattctgccaatcatgtttggtagtttgtacaaa
atctccaaagaacactggaatcagaccattgtagcactggtctacaatgtgctgaaaacc
ttaatggaaatgaatggcaagctttttgatgaccttactagctcgtacaaagctgaaaga
caaagagagaaaaagaaggaattggaacgtgaagaattatggaaaaaattagaggagcta
aagctaaagaaagctctagaaaaacagaacagtgcttacaacatgcacagtattctcagc
aatacaagtaacgaataa

DBGET integrated database retrieval system