KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502007
Entry
107502007         CDS       T06036                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A isoform X1
  KO
K05448  vascular endothelial growth factor A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04066  HIF-1 signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04370  VEGF signaling pathway
ray04510  Focal adhesion
ray04926  Relaxin signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05219  Bladder cancer
ray05323  Rheumatoid arthritis
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107502007 (VEGFA)
   04014 Ras signaling pathway
    107502007 (VEGFA)
   04015 Rap1 signaling pathway
    107502007 (VEGFA)
   04370 VEGF signaling pathway
    107502007 (VEGFA)
   04066 HIF-1 signaling pathway
    107502007 (VEGFA)
   04020 Calcium signaling pathway
    107502007 (VEGFA)
   04151 PI3K-Akt signaling pathway
    107502007 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107502007 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107502007 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107502007 (VEGFA)
   05206 MicroRNAs in cancer
    107502007 (VEGFA)
   05205 Proteoglycans in cancer
    107502007 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107502007 (VEGFA)
   05211 Renal cell carcinoma
    107502007 (VEGFA)
   05219 Bladder cancer
    107502007 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107502007 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107502007 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107502007 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107502007 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107502007 (VEGFA)
   05165 Human papillomavirus infection
    107502007 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107502007 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107502007 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107502007 (VEGFA)
Cytokines and growth factors [BR:ray04052]
 Growth factors
  Growth factors (RTK binding)
   107502007 (VEGFA)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   107502007 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 107502007
NCBI-ProteinID: XP_015984225
LinkDB
Position
Unknown
AA seq 222 aa
MGRWEPGERDVEKEWGPGLCSILVFSYCILNLPLPKWSQAAPMAEGEQKAHQVVKFMDVY
QRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIM
RIRLHKVQHIGEMSFLQHEKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRPCGPCSER
RKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 669 nt   +upstreamnt  +downstreamnt
atgggccgctgggaaccgggagagagagatgtggagaaggagtggggacctggactgtgc
agcattctggtgttttcctactgcattttgaacctcccactccccaagtggtcccaggct
gcgcccatggcagaaggagaacagaaagcccaccaagtggtgaagttcatggatgtctac
cagcgcagctactgccgtccaatcgagaccctggtggacatcttccaggagtaccccgat
gagatcgagtatatctttaagccgtcctgtgtgcccctgatgcggtgtggaggctgctgc
aatgacgagggcctggagtgtgtgcccactgaagagttcaacatcaccatgcagatcatg
cgtatcagacttcacaaagtccagcacataggagagatgagcttcctacagcatgaaaaa
tgtgaatgcagaccaaagaaagatagagcaaggcaagaaaaaaaatcagttcgaggaaag
ggaaaggggcaaaaaagaaagcgcaagaaatcccgtccctgtgggccttgctcagagcgg
agaaagcatttgtttgtacaagatccgcagacgtgtaaatgttcctgcaaaaacacagac
tcacgttgcaaggcgaggcagcttgagttaaacgaacgtacttgcagatgtgacaagcca
aggcggtga

DBGET integrated database retrieval system