KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502025
Entry
107502025         CDS       T06036                                 

Definition
(RefSeq) guanine nucleotide exchange factor VAV2-like
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04510  Focal adhesion
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray05135  Yersinia infection
ray05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107502025
   04024 cAMP signaling pathway
    107502025
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107502025
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107502025
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107502025
   04660 T cell receptor signaling pathway
    107502025
   04662 B cell receptor signaling pathway
    107502025
   04664 Fc epsilon RI signaling pathway
    107502025
   04666 Fc gamma R-mediated phagocytosis
    107502025
   04670 Leukocyte transendothelial migration
    107502025
   04062 Chemokine signaling pathway
    107502025
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107502025
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107502025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107502025
Domain-containing proteins not elsewhere classified [BR:ray04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107502025
SSDB
Motif
Pfam: RhoGEF C1_1 PH PH_10 Zn_ribbon_17 zf-RING-like C1_2
Other DBs
NCBI-GeneID: 107502025
NCBI-ProteinID: XP_015984268
LinkDB
Position
Unknown
AA seq 802 aa
MAESASPPEAVNRRRFLPPGDCAPGAAAPVASSHSAARSSETLAAIPEAVRTDTGPPCEC
SRGGCDSTPDGGPDDVLGPVQGGLEPQPIPVCGRSPCVLPSAGLRHVLDTHLPPSPRPPP
HVFVLFRCLIQARRLGTASTRDPAEPRFGQAQRQAVGGLADPAPLCHPVAVPIVGYAEGG
VGSSPTSGPPASSRPFLRCGSWPERWAGSRITVPGRRGWDAGGSSVRRRPGRTEGWGGRA
AEDGAARHSAIQDLTFDTRRWGGGGCRWGPSWPPTRHCPAASASVRAPKRHFAQRAGHGA
GAGPGSARPRGPAPREPVSGPRGAGPPESQSASVVSHRSSRGVQAVLHNVAQNKGIRPFP
SEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEVQQPMKMGMTE
DDKRNCCLLEIQETEAKYYRTLEDIEKNYMVPLRLVLSPADMVAIFINLEDLIKVHHSFL
RAVDVAMMAGGSALAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLASREDFRLKVEECT
LKVQEGKFKLQDLLVVPMQRVLKYHLLLKELLSHSTDRPERQQLKEALEAMQDLAMYINE
VKRDKETLKKISEFQSSIENLQVRLEEFGRPKIDGELKVRSIVNHTKQDRYLFLFDKVVI
VCKRRGYSYELKEVIELLCHKMTDDPMNNKDIKKWSYGFYLIHLQGKQGFQFFCKTEDMK
RKWMEQFEMAMSNIKPDKATANHHSFQMYTFDRATNCKACRMFLRGTFYQGYLCTKCGVG
AHKECLEVTPPCKTGSSADLRL
NT seq 2409 nt   +upstreamnt  +downstreamnt
atggccgagtccgcgtcgcctccagaggccgtaaatcggcgccggtttctcccgcccggt
gactgcgctcccggggccgccgcgcccgtggcgagctcgcactcggccgcccggtcctcc
gagaccctggccgccattcctgaggccgtccgcacagacacggggccgccctgtgaatgt
tcccggggcggctgtgacagcaccccagacgggggcccggacgacgtcctggggccggtc
cagggcggccttgagccccagcccatccccgtgtgtggccgcagcccctgtgtcctcccc
tcggccggcctccgccacgtgctggacacccatcttcctccatctccccggccacctcca
catgtcttcgtcctgttccgatgtctgattcaggcgcggagacttgggacagcgtccacg
cgggaccccgctgagccgcgctttggccaggcccagcgtcaggccgtggggggcctcgca
gacccagctcccctctgtcaccccgtcgctgtccccatcgtgggctacgctgagggcggg
gtagggtcctcacccacctcagggccaccggcctcctcccggccctttctgcgctgcggc
tcctggcctgagaggtgggcgggctcgcggatcaccgtgccggggcgcagaggctgggac
gcgggcgggtccagtgtccggaggaggccgggcaggacggagggctggggcggccgggcg
gcagaggacggagctgctcgccactcagcgattcaggaccttacttttgacacgcgccgg
tgggggggcgggggctgccgctggggcccctcgtggcctccgacccggcactgcccagca
gcgtccgccagtgtccgagcaccgaagcgacacttcgcgcagcgcgcgggtcacggagca
ggggccgggcccggaagtgctcggccgcggggcccggcgccccgggagccggtctccggt
ccgcgaggcgccggtcccccggaatcacagagcgcctctgttgtctcccacaggtcatct
cgcggtgtccaggctgtcctgcacaacgtggcccagaacaaaggcatcaggcctttcccc
tccgaggagaccgcagaaaatgacgacgacgtctaccgcagcctggaggagctggccgac
gagcatgacctgggcgaggacatctacgactgcgtcccgtgcgaggacgagggtgacgac
atctacgaggacatcatcaaggtggaggtgcagcagcccatgaaaatgggcatgaccgag
gacgacaagaggaactgctgcttgctggagattcaggagacggaggccaagtactaccgg
accctggaggacatcgagaagaactacatggtccccctgaggctggtgctgagccccgcg
gacatggtagccatcttcatcaacctggaggacctgatcaaggtgcaccacagcttcctg
agggccgtggacgtggccatgatggcggggggcagtgccctggccaaggtcttcctggac
ttcaaggagaggctcctgatctacggcgagtactgcagccacatggagcacgcccagaac
acgctgaaccagctgctcgccagccgggaggacttcagactgaaagtcgaggaatgcacg
ctgaaggtccaggagggaaagttcaagctgcaggacctgctggtcgtgcccatgcagagg
gtgctcaagtaccacttgctcctgaaggagctgctgagccattctaccgaccggccggag
aggcagcagctgaaagaagccctggaagccatgcaggacttggcaatgtacataaatgag
gtcaaacgggacaaggagaccctgaagaaaatcagcgagtttcagagctccatagagaac
ttgcaagtgagactggaggagtttgggaggccaaagatcgacggggagctgaaggtccgg
tccatagtcaaccacaccaagcaggacaggtacttgttcctgtttgacaaggtggtcatc
gtctgcaagaggaggggttacagctacgagctgaaggaggtcatagagctgctgtgccac
aagatgaccgacgaccccatgaacaacaaggacatcaagaagtggtcctatggcttctat
ctcatccacctgcaagggaagcagggcttccagtttttctgcaagacggaagacatgaag
aggaagtggatggagcagttcgagatggccatgtcaaacatcaagccggataaagccacc
gccaaccaccacagcttccagatgtacacgttcgacagggccaccaactgcaaagcctgc
aggatgttcctcaggggcaccttctaccagggctacctgtgcaccaagtgtggcgtcggg
gcacacaaggagtgtctggaggtgacgccgccctgcaagacgggttcatctgcagacctt
aggctctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511258
Entry
107511258         CDS       T06036                                 

Gene name
VAV1
Definition
(RefSeq) proto-oncogene vav isoform X1
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04510  Focal adhesion
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray05135  Yersinia infection
ray05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107511258 (VAV1)
   04024 cAMP signaling pathway
    107511258 (VAV1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107511258 (VAV1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107511258 (VAV1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107511258 (VAV1)
   04660 T cell receptor signaling pathway
    107511258 (VAV1)
   04662 B cell receptor signaling pathway
    107511258 (VAV1)
   04664 Fc epsilon RI signaling pathway
    107511258 (VAV1)
   04666 Fc gamma R-mediated phagocytosis
    107511258 (VAV1)
   04670 Leukocyte transendothelial migration
    107511258 (VAV1)
   04062 Chemokine signaling pathway
    107511258 (VAV1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107511258 (VAV1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107511258 (VAV1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107511258 (VAV1)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107511258 (VAV1)
SSDB
Motif
Pfam: RhoGEF SH3_1 SH3_2 CAMSAP_CH CH SH2 SH3_9 C1_1 PH CDC24 C1_2 LZ3wCH PH_16
Other DBs
NCBI-GeneID: 107511258
NCBI-ProteinID: XP_016000996
LinkDB
Position
Unknown
AA seq 845 aa
MELWRQCTHWLIQCRVLPPSHRVTWDGAQVCELAQALRDGVLLCQLLNNLLPHAINLREV
NLRPQMSQFLCLKNIRTFLSTCCEKFGLKRSELFEAFDLFDVQDFGKVIYTLSALSWTPI
AQNKGIMPFPTEEESVGDEDIYSGLSDQIDDTVEEDEDLYDCVDNDEAEGDEIYEDLMRT
EPVPMPPKMTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFMKPLQRFLKPEDIEMIFINI
EDLLRVHTHFLKEMKEALATPSGPTLYQVFIKYKERFLVYGRYCSQVESASKHLDRVASA
REDVQMKLEECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQDAMEKENLRLAL
DAMRDLAQCVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITTVERRSKM
DRYAFLLDKALLICKRRGDSYDLKDFINLHSFQIRDDSSGERDNKKWTHMFLLIEDQGAQ
GYELFFKTRELKKKWMEQFEMAISNIYPENAAANGHDFQMFSFEETTSCKACQMLLRGTF
YQGYRCHRCRAPAHKECLGRVPPCGRHGQDFSGTMKKDRLHRRAQDKKRNELGLPKMEVC
QEYYGLPPPPGAFGPFLRLSPGDIVELTKAEAEQNWWEGRNTATNEVGWFPCNRVKPYVH
GPPQDLSVHLWYAGPMERAGAESILTNRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKI
MTAEGLYRITEKKAFRGLVELVEFYQKNSLKDCFKSLDTTLQFPFKEPERRAISKPAAGS
TKYFGTAKVRYDFCARDRSELNLKEGDIVKILNKKGQQGWWRGEIYGRVGWFPSNYVEED
YSEYC
NT seq 2538 nt   +upstreamnt  +downstreamnt
atggagctgtggcgccagtgcacccactggctgatccagtgccgggtgctgccgcccagc
caccgcgtgacctgggacggggcccaggtgtgcgagctggcgcaggcccttcgggatggg
gtccttctctgtcagctgctcaacaacctgctgccccacgccatcaacttacgcgaggtc
aacttgcgcccccagatgtcccagttcctgtgccttaagaatatccgcaccttcttgtct
acctgctgtgagaagtttggcctcaagcgcagcgagctctttgaggccttcgacctcttc
gatgtgcaggattttgggaaggtcatctacactctgtctgctctgtcctggaccccgatt
gcccagaacaaggggatcatgcccttccccactgaggaggagagtgtgggcgatgaagac
atctacagtggactgtccgaccagatcgatgacacagtggaggaggatgaggacctgtac
gactgcgtggacaatgacgaggcggagggcgatgagatctacgaggacctcatgcgcaca
gagccggtgcccatgccgcccaagatgacagagtatgacaagaggtgctgctgcctgcga
gagatccagcaaacggaggagaagtacacggacacgctaggctccatccaacagcacttc
atgaagcccctgcagcggttcctcaaacctgaagacatagagatgatcttcatcaacatc
gaggacctgcttcgtgtgcacactcactttctaaaggagatgaaggaggccctggccacc
cccagtgggcccaccctctaccaggtcttcatcaagtacaaggagaggttcctcgtctat
ggccgctactgtagccaagtggagtcggccagcaagcacctggaccgcgtggccagtgcc
cgggaggacgtgcagatgaagctagaggaatgttcccagcgagcaaacaacgggaggttc
accttgcgggacctgctgatggtgcccatgcagcgcgtgctcaagtaccacctgcttctc
caggagctggtgaaacacacgcaggacgcgatggagaaggagaacctgcggctggccctg
gacgccatgagggacttggctcagtgcgtgaacgaggtcaagcgggacaacgagaccctg
cggcagatcaccaacttccagctgtccatcgagaacctggaccagtctctggcccactac
ggccggcccaagatcgatggcgagctcaagatcaccacggtggagcggcgctcgaagatg
gaccggtacgccttcctgctggacaaagcgctgctcatctgcaagcgccgaggggactcc
tacgacctcaaagactttatcaacctgcacagcttccagattcgggacgactcttctgga
gagcgcgacaacaagaagtggactcacatgtttctcctgatcgaggaccaaggcgctcag
ggctatgagctgttcttcaagacgcgagaactgaagaagaagtggatggagcagttcgag
atggccatctcgaacatctaccctgagaatgccgctgccaatgggcatgacttccagatg
ttctcctttgaggagaccacgtcctgcaaggcttgccagatgctgctgagaggcaccttc
tatcagggctatcgctgtcatcggtgccgggcacctgcacacaaggagtgtctggggagg
gtccctccctgtggccgccatgggcaagatttttctggaactatgaagaaggacaggctg
catcgccgggctcaggacaaaaaaagaaatgaactggggctgcccaagatggaggtgtgc
caggagtactatgggcttcccccgccccccggagcctttggccctttcctgcggctcagc
cctggagatatcgtggagctcaccaaggccgaggccgagcagaactggtgggagggcagg
aacacggctaccaatgaagttggctggtttccttgtaacagggtcaagccctacgtgcac
ggcccccctcaggacctgtccgttcacctctggtacgctggccccatggagcgtgccgga
gccgagagcatcctcaccaaccgctcagacgggacgttcctggtgcggcagagggtgaag
gatgccgcggagttcgccatcagcattaagtataatgttgaggtcaagcacattaaaatc
atgacagcggaaggactgtaccggattacagagaagaaggctttccggggactggtggag
ctggtggagttttaccagaagaactccctaaaggattgcttcaagtctctggacaccacc
ctgcagtttcccttcaaggagcctgagaggagagccatcagcaaaccagcagcaggaagc
accaagtactttggcacagccaaagtccgctacgacttctgcgcccgggatcgatcggag
ctgaacctcaaggagggggacatcgtcaagattctcaacaagaaggggcaacagggctgg
tggcgaggggagatctatggccgggtcggctggttcccctccaactacgtggaggaggat
tattctgaatactgctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518292
Entry
107518292         CDS       T06036                                 

Gene name
VAV3
Definition
(RefSeq) guanine nucleotide exchange factor VAV3 isoform X1
  KO
K05730  guanine nucleotide exchange factor VAV
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04510  Focal adhesion
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray05135  Yersinia infection
ray05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107518292 (VAV3)
   04024 cAMP signaling pathway
    107518292 (VAV3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107518292 (VAV3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107518292 (VAV3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107518292 (VAV3)
   04660 T cell receptor signaling pathway
    107518292 (VAV3)
   04662 B cell receptor signaling pathway
    107518292 (VAV3)
   04664 Fc epsilon RI signaling pathway
    107518292 (VAV3)
   04666 Fc gamma R-mediated phagocytosis
    107518292 (VAV3)
   04670 Leukocyte transendothelial migration
    107518292 (VAV3)
   04062 Chemokine signaling pathway
    107518292 (VAV3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107518292 (VAV3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107518292 (VAV3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107518292 (VAV3)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107518292 (VAV3)
SSDB
Motif
Pfam: RhoGEF SH3_2 CAMSAP_CH CH SH3_1 SH2 SH3_9 C1_1 PH CDC24 Filamin C1_2 PH_10 Prok-RING_1 PH_16 LZ3wCH zf-RING-like
Other DBs
NCBI-GeneID: 107518292
NCBI-ProteinID: XP_016015280
LinkDB
Position
Unknown
AA seq 847 aa
MEPWKQCAQWLIHCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRARSINLKEI
NLRPQMSQFLCLKNIRTFLMACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPI
ALATGIRPFPTEESVNDEDIYKGLPDLIDETRVEDEEDLYDCVYGEDEGGEVYEDLMKAE
EAHQPKCLENDIRSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPE
LVKVHRNLMQEIQDSIVNKNDQNLYQIFINYKERLVIYGQYCSAVESAISSLDYISKTKE
DVKLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPVEKANLKLALDA
MKDLAQYVNEVKRDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQER
HIFLFDLAVIVCKRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHIQGQNGL
EFYCKTKDLKKKWLEQFEMALSNIRPDYADSNFHEFKMHTFSRVTSCRVCQMLLRGTFYQ
GYLCFKCGAKVHKECLGRVDNCGRANSAEQGTLKPPEKRTNGLRRASRQVDPGLPKMQVI
RNYTGTPPPGLHEGPPLHIQAGDTVELLRGDAHSLFWQGRNLASGEVGFFPSDAVKPCPC
VPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIK
ILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHAAGQRGSRT
GNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKLSANGWWRGEVNGKVGWFPS
TYVEMDE
NT seq 2544 nt   +upstreamnt  +downstreamnt
atggagccgtggaagcagtgcgcgcagtggctcatccactgcaaggtgctgcccgccaac
caccgggtgacctgggactcggcgcaggtgttcgacctggcgcagaccctccgcgatgga
gtcctgctctgccagctgctcaacaacctccgggcgcgctccatcaacctgaaggagatc
aacctgaggccgcagatgtcccagtttctctgtttgaagaacataagaacattcctcatg
gcctgttgcgagacatttggaatgagaaaaagtgaactcttcgaggcgtttgacctgttt
gatgttcgagactttggaaaggttatagaaacattgtcgcggctttctcgcacgcctata
gccttggccacaggaatcaggcccttcccaacagaagaaagcgttaatgatgaagacatc
tacaaaggccttccggatttgatagatgaaacccgcgtggaggatgaagaagatctgtat
gactgtgtctatggggaggacgaaggtggagaagtctacgaggacttaatgaaagccgag
gaagcacatcaacctaaatgtctggaaaatgacatacgaagttgctgcctagcagaaatt
aagcaaacagaagaaaaatatacagaaacactggagtcaatagaaaaatatttcatggca
ccactaaaaagatttctgacagcagcagaatttgattcagtattcatcaacattcctgaa
cttgtaaaagttcatcggaacttaatgcaagagattcaagattccattgtaaataaaaat
gaccagaacttgtatcaaattttcattaactacaaggaaaggttggttatttatgggcag
tactgcagtgcagtggagtcggccatctccagtttagactacatttcaaagacaaaagaa
gacgtcaaactgaaattagaggaatgttccaaacgagccaataatgggaaattcactctt
cgagatttgcttgtggttcctatgcagcgagttttaaagtatcaccttctcctccaggaa
ctggtcaaacacaccaccgatcctgtagagaaggcaaatctgaaactggctcttgatgcc
atgaaggacttggcacaatatgtgaatgaagtgaagagagataatgagacacttcgtgaa
attaaacagttccagctctctatagaaaatttgaaccaaccagttttgctttttggacga
cctcagggagacggcgaaattcgaataactactttagacaagcacacgaaacaagaaagg
catatcttcttatttgatttggcagtgattgtctgtaaaaggaaaggtgataactatgaa
atgaaggaaataatagatcttcagcagtacaagatagccaacaatcctacaactgataaa
gaaaataaaaagtggtcttatggcttctacctcatccacatccaaggacaaaatgggtta
gaattttattgcaaaacaaaagatttaaagaaaaaatggctggaacagttcgaaatggct
ttgtctaacataaggccagactatgcggactccaacttccacgagttcaagatgcacacc
ttcagccgggttacatcctgcagagtctgccagatgctcctgagaggaacgttttaccaa
ggctatttatgttttaagtgtggcgcaaaagtacacaaggaatgtttgggaagagtagac
aattgcggcagagctaattctgctgaacaagggacgctcaaaccacctgagaaacggacc
aatggactccgaagagcctcccgacaagtggatccaggtttaccaaagatgcaggtcatt
aggaactacaccgggacgccacccccgggtcttcatgaaggacccccgttacacatccag
gcaggggatacagttgaacttctgagaggagacgcacacagtctgttttggcagggtaga
aatttagcatctggagaggtcggattttttccgagtgatgctgtcaagccttgcccatgt
gtgcccaaaccagtagattattcttgccaaccctggtatgctggagccatggaaagattg
caggcagagactgaacttattaatagggtaaatagtacttaccttgtgaggcacaggacc
aaagagtctggagaatatgcaattagcattaagtacaataatgaagcaaagcacatcaag
attttaacaagagatggcttttttcacattgcagaaaatagaaaatttaaaagtttaatg
gaacttgtggagtattacaagcatcattctcttaaggaagggttccgaaccctcgatacc
actctgcagtttccatacaaggagccagaacacgcagccggacagaggggcagcagaacg
ggcaacagcttgttaagtccgaaagtgctgggcatcgccatcgctcgctatgacttctgc
gcgagagacatgcgagaactgtccttgctgaaaggagacgtggtgaagatctacacgaag
ctgagtgcgaacggctggtggcgaggagaagtgaacggcaaggtgggctggtttccatct
acgtacgtggaaatggatgaataa

DBGET integrated database retrieval system