KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502027
Entry
107502027         CDS       T06036                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha isoform X1
  KO
K08524  retinoid X receptor alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03320  PPAR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04659  Th17 cell differentiation
ray04919  Thyroid hormone signaling pathway
ray04920  Adipocytokine signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04932  Non-alcoholic fatty liver disease
ray04976  Bile secretion
ray05160  Hepatitis C
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05216  Thyroid cancer
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107502027 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107502027 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107502027 (RXRA)
   03320 PPAR signaling pathway
    107502027 (RXRA)
   04919 Thyroid hormone signaling pathway
    107502027 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    107502027 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    107502027 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107502027 (RXRA)
   05202 Transcriptional misregulation in cancer
    107502027 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    107502027 (RXRA)
   05216 Thyroid cancer
    107502027 (RXRA)
   05222 Small cell lung cancer
    107502027 (RXRA)
   05223 Non-small cell lung cancer
    107502027 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107502027 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107502027 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107502027 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ray03310]
    107502027 (RXRA)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    107502027 (RXRA)
Nuclear receptors [BR:ray03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   107502027 (RXRA)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 107502027
NCBI-ProteinID: XP_015984273
LinkDB
Position
Unknown
AA seq 467 aa
MDTKHFLPLDFSTQVSSSSLGSPTGRSSMAAPSLHPSLGPGLGASLGSPGQLHSPISTLS
SPVNGMGPPFSVISSPMGPHSISVPTTPTLGFGTSSPQLSSPMNPVNSSEDIKPPLGLNG
VLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNK
DCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRGEAEAEPASSANEDMPVEKI
LEAEEAVEPKTETYVEANMGLNPSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSELPLD
DQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVS
KMRDMHMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQPGRF
AKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggacactaaacatttcctgccgctcgacttctccacccaggtgagctcctcgtccctc
ggctcccccacgggacgcagctccatggccgcaccctcgctgcacccctcgctggggccc
ggcctcggcgcctcgctgggctccccggggcagctgcactcacccatcagcacgctgagc
tcccctgtcaacggcatgggcccgcccttctcggtcatcagctcccccatgggcccccac
tccatatccgtgcccaccacgcccaccctgggcttcggcaccagcagcccccagctcagc
tcgcccatgaaccccgtcaacagcagcgaggacatcaagccccccctgggcctcaatggc
gtcctcaaagtccccgcccacccctcagggaacatggcgtccttcaccaagcacatctgc
gccatctgcggggaccgctcctcaggcaagcactacggcgtgtacagctgcgaaggctgc
aagggcttcttcaagcgcacggtgcgcaaggacctgacctacacctgccgggacaacaag
gactgcctgatcgacaagcgccagcgcaaccgctgccagtactgccgctaccagaagtgc
ctggccatgggcatgaagcgcgaagctgtgcaggaggagaggcagcggggcaaggaccgc
ggcgaggccgaggccgagcccgcgagcagcgccaacgaggacatgcccgtggagaagatc
ctggaggccgaggaggccgtcgagcccaagaccgagacgtacgtggaggccaacatgggg
ctgaaccccagctcgcccaatgaccccgtcaccaacatctgccaagcggcggacaagcag
ctgttcaccctggtcgagtgggccaagcggatcccgcacttctccgagctgccgctggac
gaccaggtcatcctgctgcgggccggctggaacgagctgctcatcgcctccttctcccac
cggtccatcgccgtgaaggacgggatcctgctggccaccggcctgcacgtgcaccggaac
agcgcccacagcgctggcgtgggcgccatcttcgacagggtgctgacggagctggtgtcc
aagatgcgggacatgcacatggacaagacggagctgggctgcctgcgcgccatagtgctc
ttcaacccggactccaaggggctctcgaacccggccgaggtggaggcgctgcgggagaag
gtgtatgcgtccctggaggcctactgcaaacacaagtaccccgagcagccagggaggttc
gccaagctgctgctgcgcctgccggccctgcgctccattggcctcaagtgcctggagcac
ctcttcttcttcaagctcatcggagacacgcccatcgacaccttcctcatggagatgctg
gaggccccgcaccagctgacctag

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107511984
Entry
107511984         CDS       T06036                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X1
  KO
K08525  retinoid X receptor beta
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03320  PPAR signaling pathway
ray04659  Th17 cell differentiation
ray04919  Thyroid hormone signaling pathway
ray04920  Adipocytokine signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05216  Thyroid cancer
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107511984 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107511984 (RXRB)
   03320 PPAR signaling pathway
    107511984 (RXRB)
   04919 Thyroid hormone signaling pathway
    107511984 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    107511984 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107511984 (RXRB)
   05202 Transcriptional misregulation in cancer
    107511984 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    107511984 (RXRB)
   05216 Thyroid cancer
    107511984 (RXRB)
   05222 Small cell lung cancer
    107511984 (RXRB)
   05223 Non-small cell lung cancer
    107511984 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107511984 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ray03310]
    107511984 (RXRB)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    107511984 (RXRB)
Nuclear receptors [BR:ray03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   107511984 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 107511984
NCBI-ProteinID: XP_016002500
LinkDB
Position
Unknown
AA seq 545 aa
MLENFPHLNYAPLSPASCHYDWELNCCVTDSPVYGLGDGGACGGCSGCVGVQWRIRESLQ
LDDRGLIFSFCLSCLCVSVPLCTLPLDSGSPDSSSPNPLPQGAPPHSPPGPPLPPSAAPS
LGGSGAPPPPPMPPPSLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGG
SGPPEDVKPPVLGVRGLHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRT
IRKDLTYSCRDNKDCTVDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGA
GGAPEEMPVDRILEAELAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVE
WAKRIPHFSSLPLDDQVILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAG
VGAIFDRSLSRVLTELVSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVY
ASLETYCKQKYPEQQGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEA
PHQLA
NT seq 1638 nt   +upstreamnt  +downstreamnt
atgcttgaaaattttcctcacctgaactatgctcctttgtcacccgcctcctgtcattac
gattgggagttaaactgttgtgtgacagacagcccggtgtatggacttggggatggtggt
gcgtgtggtgggtgtagtgggtgtgttggggtgcagtggaggattagagaaagtcttcag
ttggacgatcgaggactcattttttctttttgtctctcctgtctgtgtgtgtctgtacct
ctgtgtacccttcccttagattccggaagtccagacagttcctccccaaatccccttccc
cagggtgctcctccccattctcctcctgggccacccctacccccttcagcagccccatcc
cttggaggctctggggcaccacccccacccccaatgccaccaccctcactgggctcccct
ttcccagttatcagctcttccatggggtcccctgggctgccccctccagctcccccagga
ttctccgggcctgtcagcagtccccagattaactcaacagtgtcgctccctgggggtggg
tctggcccccctgaagatgtgaagccaccagtcttaggggtccggggcctgcactgtcca
ccccctccaggtggccctggggctggcaaacggctatgtgcaatctgcggggaccgaagc
tcaggcaaacactatggagtttacagttgtgagggctgcaaaggctttttcaagcgcacc
attcgtaaggacctgacctattcatgccgggacaacaaggactgcactgtggataagcgt
cagcggaaccgctgtcagtactgccgctatcagaagtgcctggctactggtatgaagagg
gaagcggtacaggaggagcgtcagcgggggaaggacaaggatggggatggggagggggcc
gggggagcccccgaggagatgcctgtggacaggatcctggaggcagagcttgctgtggag
cagaagagtgaccagggcgttgagggtcctgggggaaccgggggtagcggcagcagccca
aatgaccctgtgactaacatctgtcaggcagctgacaaacagctattcacgcttgttgag
tgggcgaagaggatcccacacttttcctccttgcctctggatgaccaggtcatattgcta
cgggcaggctggaatgagctcctcattgcctccttctcccatcgatccattgatgtacga
gatggcatcctccttgccacaggtcttcacgtgcaccgcaactcagctcattctgcaggc
gtgggagccatctttgatcggtccctctccagggtgctgacagagctagtgtccaaaatg
cgtgacatgaggatggacaagacagagcttggctgcctgagggcaatcattctgttcaat
ccagatgccaagggtctttccaatcccagtgaggtagaggtccttcgggaaaaagtgtat
gcatcactggaaacctattgcaaacagaagtaccctgagcagcagggacggtttgctaag
ctgctgctacgtcttcctgccctcaggtccattggccttaagtgtctagagcatctgttt
ttcttcaagctcattggtgacacccctattgacaccttcctcatggagatgctggaggca
ccccaccaactggcctga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107512732
Entry
107512732         CDS       T06036                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X1
  KO
K08526  retinoid X receptor gamma
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03320  PPAR signaling pathway
ray04659  Th17 cell differentiation
ray04919  Thyroid hormone signaling pathway
ray04920  Adipocytokine signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05216  Thyroid cancer
ray05222  Small cell lung cancer
ray05223  Non-small cell lung cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    107512732 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107512732 (RXRG)
   03320 PPAR signaling pathway
    107512732 (RXRG)
   04919 Thyroid hormone signaling pathway
    107512732 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    107512732 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107512732 (RXRG)
   05202 Transcriptional misregulation in cancer
    107512732 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    107512732 (RXRG)
   05216 Thyroid cancer
    107512732 (RXRG)
   05222 Small cell lung cancer
    107512732 (RXRG)
   05223 Non-small cell lung cancer
    107512732 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107512732 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ray03310]
    107512732 (RXRG)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    107512732 (RXRG)
Nuclear receptors [BR:ray03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   107512732 (RXRG)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 107512732
NCBI-ProteinID: XP_016004041
LinkDB
Position
Unknown
AA seq 463 aa
MYGNYPHFVKFPTGFGGSPSHPGATSVSPSAALSTGKLADACPGYTDTPVSAPRPLSAVG
NPLNALGSPYRVIASALGPPSGALAAPPGVNLVAPPSSQLNVVNGVSISEDIKPLPGLPG
VGSMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLVYTCRDNKD
CLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRSRERAESEAECAAGGRGDMPVARIL
EAELAVEPKTESYGDVNVESSMNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQVP
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtacgggaattacccgcacttcgtgaagtttcccaccggcttcggcggctcccccagc
caccccggtgccacgtccgtgagcccatcggcagccttgtccacggggaagctggcagac
gcgtgccccggctacaccgacaccccggtgagcgccccgcggcccctgagcgcggtgggg
aaccctctgaacgccctgggctctccataccgagtcatcgcctccgccctgggcccgccc
tcgggagcgctggcggcccctccgggggtcaacctggtggctccgcccagctcgcagctc
aatgtggtcaatggtgtcagcatttctgaggacataaagcccttaccagggcttcctgga
gttggaagcatgaactacccgtccaccagccctggctctctggtcaaacacatctgtgcc
atctgtggggacagatcctcaggcaagcactacggcgtgtacagctgcgagggctgcaag
gggttcttcaagaggacgatccggaaggacctcgtctacacctgccgggacaacaaggac
tgcctgatcgacaagcgccagcgcaaccgctgccagtactgccgctaccagaagtgcctg
gccatgggcatgaagcgcgaagccgtgcaggaagagaggcagaggagccgggagcgggcg
gagagcgaggcggagtgtgccgctggcggccgcggagacatgcccgtggcgaggattcta
gaagccgaactcgctgttgaaccaaagacggagtcctacggcgacgtgaacgtggagagc
tcgatgaatgaccctgtcaccaacatatgccacgctgctgacaagcagctcttcacgctc
gtcgagtgggccaagcgcatcccgcacttctccgacctcaccttggaggaccaggtcatt
ctgctccgggcagggtggaacgagctgctcatcgcctccttctcccaccgctccgtgtcg
gtgcaggacgggatcctcctggccacggggctgcacgtgcaccgcagcagcgcccacagc
gccggggtgggctccatctttgacagagtcctgactgagctggtctccaagatgaaggac
atgcagatggacaagtcggagctgggctgcctgcgagccatcgtgctgttcaacccagat
gccaagggtctgtccaacccctctgaggtggagactctgcgggagaaggtctacgccacc
ctcgaggcctacaccaagcagaagtacccagagcaaccgggcaggttcgccaagctgctg
ctgcgcctgcccgcgctgcgctccattggcctcaagtgcctggagcacctcttcttcttc
aagctcatcggggacacgcccatcgacaccttcctcatggagatgctggagaccccgctg
caggtcccctga

DBGET integrated database retrieval system