KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502212
Entry
107502212         CDS       T06036                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6 isoform X1
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01524  Platinum drug resistance
ray04010  MAPK signaling pathway
ray04060  Cytokine-cytokine receptor interaction
ray04115  p53 signaling pathway
ray04210  Apoptosis
ray04217  Necroptosis
ray04650  Natural killer cell mediated cytotoxicity
ray04668  TNF signaling pathway
ray04932  Non-alcoholic fatty liver disease
ray04940  Type I diabetes mellitus
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05142  Chagas disease
ray05143  African trypanosomiasis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05320  Autoimmune thyroid disease
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107502212 (FAS)
   04668 TNF signaling pathway
    107502212 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107502212 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107502212 (FAS)
   04217 Necroptosis
    107502212 (FAS)
   04115 p53 signaling pathway
    107502212 (FAS)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    107502212 (FAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107502212 (FAS)
   05205 Proteoglycans in cancer
    107502212 (FAS)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    107502212 (FAS)
   05330 Allograft rejection
    107502212 (FAS)
   05332 Graft-versus-host disease
    107502212 (FAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107502212 (FAS)
   05022 Pathways of neurodegeneration - multiple diseases
    107502212 (FAS)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107502212 (FAS)
   04932 Non-alcoholic fatty liver disease
    107502212 (FAS)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107502212 (FAS)
   05161 Hepatitis B
    107502212 (FAS)
   05160 Hepatitis C
    107502212 (FAS)
   05164 Influenza A
    107502212 (FAS)
   05162 Measles
    107502212 (FAS)
   05168 Herpes simplex virus 1 infection
    107502212 (FAS)
   05163 Human cytomegalovirus infection
    107502212 (FAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107502212 (FAS)
   05169 Epstein-Barr virus infection
    107502212 (FAS)
   05165 Human papillomavirus infection
    107502212 (FAS)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107502212 (FAS)
   05143 African trypanosomiasis
    107502212 (FAS)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107502212 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ray04050]
    107502212 (FAS)
   04090 CD molecules [BR:ray04090]
    107502212 (FAS)
Cytokine receptors [BR:ray04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   107502212 (FAS)
CD molecules [BR:ray04090]
 Proteins
  107502212 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6 DUF4381 Bac_transf
Other DBs
NCBI-GeneID: 107502212
NCBI-ProteinID: XP_015984710
LinkDB
Position
Unknown
AA seq 337 aa
MTGLGVLLPLIVTFIAGPLSKGDNTQVTGINSEVLKSTHNITERAAECPEDLHREGEFCC
QLCPPGTRKDTGCTTDRGKPGCVPCPEGEEYTDKAHYSSKCRRCRICDGEQGLEVEKNCT
QIQNTQCRCKSNFFCDIPPCEHCNPCDTCEHGISENCTPTNNTKCKVFPSTGSRLDLLWL
LLLLLIPILILAGLRIWKWKRQGRNNVGRHESTASIPKMVSMNFSDIDLSKYITTIAEQM
KITQVREFVRKNGINEAKIDEIRNDNPQDTAEQKVQLLRNWYQLHGKKDAYCTLIQSLRK
AKLCVLAEKIQDMVQKDMDNEHENADSRNENESQCLV
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaccgggctcggggttctcctgcctctgatagttacctttattgctggaccattgtct
aaaggtgataatacccaagtgaccggtatcaactctgaggtgttgaaatcaactcataac
attacggaaagggcggctgagtgcccggaagacctccatcgtgagggtgaattctgctgt
cagctatgtcctcctggcacacggaaagatactggctgtacaactgataggggcaaacca
ggctgtgttccctgtccagaaggggaggagtacacagacaaggcacactattcttctaaa
tgcagaagatgtagaatttgtgatggagaacaaggcttagaagtggaaaaaaactgtacc
cagatccagaatacccagtgcagatgtaaatcaaactttttttgtgacattcctccatgc
gaacactgtaatccttgtgacacgtgtgaacatggaatcagtgagaattgcacaccaacc
aacaacaccaaatgtaaagtgttcccatctacaggatccagacttgaccttctgtggctc
ctcctcctcctcctcatcccgattttaatattggcaggactacgaatttggaagtggaaa
agacaaggcaggaataatgttggtcgccatgaatctacagcttcaattcctaaaatggtt
tcaatgaatttctcagacatcgacttgagtaaatatattaccactattgctgagcaaatg
aaaataactcaagttagagaattcgttcggaagaatggtatcaatgaagccaaaatagat
gaaatcaggaatgacaatccccaagatacagctgaacagaaggtccagctgctccgtaat
tggtatcaacttcacgggaagaaagatgcatattgcactttgattcaaagtcttaggaaa
gccaaactttgtgtccttgcagagaaaattcaagatatggtccaaaaggacatggataat
gaacatgaaaatgccgactccagaaatgaaaatgaaagccaatgcttggtctaa

DBGET integrated database retrieval system