KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502214
Entry
107502214         CDS       T06036                                 

Gene name
ACTA2
Definition
(RefSeq) actin, aortic smooth muscle
  KO
K12313  actin, aortic smooth muscle
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04926  Relaxin signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107502214 (ACTA2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    107502214 (ACTA2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107502214 (ACTA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107502214 (ACTA2)
   04147 Exosome [BR:ray04147]
    107502214 (ACTA2)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     107502214 (ACTA2)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107502214 (ACTA2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 107502214
NCBI-ProteinID: XP_015984713
LinkDB
Position
Unknown
AA seq 377 aa
MCEEEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtgtgaagaggaggacagcactgccctggtgtgtgacaatggctctgggctttgtaag
gcgggctttgctggggatgatgctcccagggctgttttcccatccattgtgggacgtccc
agacatcagggagtaatggtgggaatgggacaaaaagacagctatgtgggtgatgaagca
caaagcaaaagaggcatcctgaccttgaagtacccgatagaacacggcatcatcaccaac
tgggatgacatggaaaagatctggcaccactctttctacaatgaacttcgtgttgcccca
gaagagcatccaactctgctcaccgaggcacccctgaaccccaaggccaatcgggaaaaa
atgacccagattatgtttgagactttcaatgtcccagccatgtatgtggctattcaggca
gtgctgtccctctacgcctctggacgtacaactggcattgtgctggactctggagatggt
gtcacccacaacgtacccatctatgagggctatgccctgccccatgccatcatgcgtctg
gacctggctggccgagatctcaccgactacctcatgaagatcctgacagagcggggctac
tcctttgtgactacagctgagcgtgaaattgtccgggacatcaaggagaaactgtgctat
gtagctctggactttgaaaatgagatggccactgccgcatcctcctcctctcttgagaag
agctatgagctgccagatgggcaggtgatcaccattgggaatgagcgcttccgctgccca
gagaccctgttccagccgtccttcatcggaatggagtctgctggcatccatgaaaccacc
tacaacagcatcatgaagtgtgatattgacatcaggaaggacctctatgctaacaacgtc
ctctctgggggtaccaccatgtaccccggcattgcggaccgcatgcagaaggagatcacg
gccctagcacccagcaccatgaagatcaagattattgcccctccagagcgcaaatactct
gtctggatcggcggctccatcctggcctctctgtccaccttccagcagatgtggatcagc
aaacaggagtacgatgaagccgggccatccattgtccaccgcaaatgcttctaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502939
Entry
107502939         CDS       T06036                                 

Gene name
ACTG2
Definition
(RefSeq) actin, gamma-enteric smooth muscle
  KO
K12315  actin, gamma-enteric smooth muscle
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04270  Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107502939 (ACTG2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107502939 (ACTG2)
   04147 Exosome [BR:ray04147]
    107502939 (ACTG2)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     107502939 (ACTG2)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   107502939 (ACTG2)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 107502939
NCBI-ProteinID: XP_015986194
LinkDB
Position
Unknown
AA seq 376 aa
MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
SKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKM
TQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLD
LAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKS
YELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVL
SGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK
PEYDEAGPSIVHRKCF
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgtgtgaagaggagaccactgcacttgtgtgtgacaatggctctggcctgtgcaaggcc
ggctttgcaggagatgatgccccgcgggctgtcttcccttccatcgtgggccgccctcgc
caccagggtgtgatggtgggaatgggccagaaagacagctatgtgggggatgaggctcag
agcaagcgcgggattctgactctcaaataccccattgaacacggcatcatcaccaactgg
gatgacatggagaagatctggcaccactccttctacaacgaactgcgggtagcacctgaa
gagcatcctaccctgctcacggaagcacccctaaatcccaaggctaacagggagaagatg
acccagatcatgtttgaaaccttcaatgtccctgccatgtatgttgccattcaagctgtg
ctctctctctacgcctctggccgcacaaccggcatcgtcctggattcaggagatggcgtc
acccataacgtccccatctatgaaggctacgcactgccccatgccatcatgcgccttgac
ctggctggccgcgacctcacggactacctcatgaagatcctcacagaaagaggctattcc
tttgtgaccacagccgagcgagaaatcgtgagagatatcaaagagaagctgtgctatgtg
gccctagattttgagaatgagatggccacagcagcctcctcttcctccctggagaagagc
tatgagctgccagatggacaggtcatcaccattggcaatgagcgcttccgctgcccagag
accctcttccagccttccttcattggcatggaatctgctggaattcatgaaacaacctac
aattccatcatgaagtgtgacattgacatccgcaaggacttatacgccaacaatgtcctc
tccgggggtactactatgtaccctggcattgctgacaggatgcagaaggagatcacagcc
ctggcccccagtaccatgaagatcaagattattgctcccccagagcggaagtactcagtc
tggattggaggttccatcctggcttctctctccaccttccagcagatgtggattagcaag
ccagagtatgatgaggcagggccctccattgttcacaggaagtgcttctaa

DBGET integrated database retrieval system