KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502272
Entry
107502272         CDS       T06036                                 

Gene name
HTR2A
Definition
(RefSeq) 5-hydroxytryptamine receptor 2A
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04540  Gap junction
ray04726  Serotonergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107502272 (HTR2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107502272 (HTR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107502272 (HTR2A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    107502272 (HTR2A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107502272 (HTR2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107502272 (HTR2A)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107502272 (HTR2A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107502272
NCBI-ProteinID: XP_015984821
LinkDB
Position
Unknown
AA seq 472 aa
MDVLCEENISLSSSPNSLMQVNDDTRLYNNDFNSREANTSDAFNWTVDSENRTNLSCEGC
LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHTLCAISLDRYVAIQN
PIHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGS
FVSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSI
HREPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDIIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQKGQKKNSQKDAKMTDNDCTMVALGKRNSEDAPRDNIINTVNEKVSCV
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggatgttctttgtgaagaaaacatttctttgagttcaagtccgaactccttaatgcaa
gtaaatgatgacacaaggctctacaataacgactttaactccagagaagctaacacttca
gatgcatttaactggacagtggactcagaaaatcgaaccaacctttcctgtgagggctgt
ctctcaccaccatgcttctccttacttcatctccaggaaaaaaactggtctgctttgttg
acagctgtagtgattattctaaccattgctggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaacgccaccaactatttcctgatgtcacttgccatagccgat
atgctgctgggtttccttgtcatgcccgtgtccatgctaaccatcctgtatggttaccgg
tggcctctgcctagcaagctctgcgcagtctggatttacctggatgtgctcttctcaaca
gcctccatcatgcacactctctgtgccatctcgctggaccgctatgttgctatccagaac
cccattcatcacagccgtttcaattccaggactaaagcatttctgaaaataattgctgta
tggaccatatcagtaggtatatccatgccaataccagtctttggactacaggatgattcc
aaggtctttaaggaaggaagttgcttactcgctgatgacaactttgtcctgatcggctct
ttcgtgtcttttttcattcccttaaccatcatggtgataacctactttttaactatcaag
tcactccagaaagaagctactttgtgtgtgagtgatcttggcacacgggccaaattagct
tctttcagcttcctccctcagagttccctgtcttcagaaaagctcttccagcggtccatc
cacagggagccaggatcctacggcaggaggactatgcagtccatcagcaatgagcaaaaa
gcctgcaaggtgctgggcattgtcttctttctgtttgtggtgatgtggtgccccttcttc
atcacgaacataatggccgtcatctgcaaagagtcctgcaatgaggatatcattggagca
ctgcttaatgtgttcgtttggatcggttacctctcctcagcagtcaacccactagtgtat
acactgtttaacaagacctataggtcagccttttcgcggtatattcagtgtcagtacaag
gaaaataaaaaaccattgcagttaattttagtaaacactatcccagccctggcctacaag
tctagtcaactccaaaagggacaaaaaaagaattcacagaaagatgccaagatgacagat
aacgactgcactatggttgctctaggaaaacgaaattcagaagatgctcctagagacaat
attatcaacacagtaaatgaaaaggttagctgtgtgtga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107503628
Entry
107503628         CDS       T06036                                 

Gene name
HTR2C
Definition
(RefSeq) LOW QUALITY PROTEIN: 5-hydroxytryptamine receptor 2C
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04540  Gap junction
ray04726  Serotonergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107503628 (HTR2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107503628 (HTR2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107503628 (HTR2C)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    107503628 (HTR2C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107503628 (HTR2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107503628 (HTR2C)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107503628 (HTR2C)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx Pox_P21 DUF1385
Other DBs
NCBI-GeneID: 107503628
NCBI-ProteinID: XP_015987697
LinkDB
Position
Unknown
AA seq 434 aa
MEAALSALFLVPANADFLSMNPERASDPPPVSQSELLKSLLLAGTLGWGAPKGDQDPLSF
SGASAASMSLLVILQTPVGXIIYILSSLSSLSDYVWPLPRYLCPVWISLDVLFSTASIMH
LCAISLDRYVAIRNPIEHSHFNSRTKAIMKIAIVWAISVGVSVPIPVIGLRDEDKVFVSN
TTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIHVLRKQALMLLHGHGHTEEPPRISLD
FLKCCKNTTDENSVNPNHDLNPRGRKKKERRPRGTMQAINNERKASKVLGIVFFVFLIMW
CPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKVYRRAFSNYLR
CNYKAEKKPPVRQMPRVVATVLSGRELNVNIYRHTNEPVIKKTIDNEPGIEMQVENLELP
VNPSNIVSERISSV
NT seq 1305 nt   +upstreamnt  +downstreamnt
atggaagctgctctatcggccctctttctggtgccagctaatgcagactttctcagtatg
aatccagagcgagcctctgacccacctccggtgtcccagtcagagttattgaaatctctt
ctcttggctgggaccctgggttggggagcccccaaaggagaccaggatcccctctccttc
agtggagcctctgcagcctcgatgtccctcctggtgatcctccaaacacctgtgggatga
ataatatatattttatcttctctctcttctctttcagattatgtctggccactacctaga
tatttgtgccccgtctggatttctttggatgttttattttctacggcgtccatcatgcac
ctctgcgctatctcgctggatcggtatgtagcaatacgtaatcctattgagcatagccat
ttcaattcacggactaaggccatcatgaagattgctattgtttgggcaatttctgtaggt
gtatcagttcctatcccagtgattggactgagagatgaagacaaagtgtttgtcagtaac
accacctgtgtgctgaatgacccaaattttgttcttattgggtccttcgtagctttcttc
ataccgctgaccatcatggtgattacgtactgcctgacgatccacgttcttcgcaaacaa
gctctgatgttactgcacggccacggccacaccgaggaaccacccagaataagcctggat
ttcctgaagtgctgcaagaataccactgatgaaaactctgtaaaccctaaccacgatttg
aacccacgcggaagaaagaaaaaagaaagacgtcctcggggcaccatgcaagctatcaac
aatgaacggaaagcatcgaaagtcctcggcattgttttctttgtgtttctgatcatgtgg
tgcccgttttttattaccaatattctgtcagttctttgtgggaaagcatgtaatcaaaag
ctcatggaaaaacttctgaatgtgtttgtttggattggctatgtttgttcaggaattaat
cctctggtgtacactcttttcaacaaagtttaccgaagggctttttccaactacttgcgt
tgcaattataaggcagaaaaaaagcctcctgtcaggcaaatgcctagagttgttgctact
gtgctctctgggagggaactcaatgttaacatttaccggcacaccaacgaaccagtgata
aagaaaactattgacaacgagcccgggatagagatgcaagttgagaatttggagctacca
gtcaatccctccaatatagttagtgaaaggattagtagtgtgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107504978
Entry
107504978         CDS       T06036                                 

Gene name
HTR2B
Definition
(RefSeq) 5-hydroxytryptamine receptor 2B
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04540  Gap junction
ray04726  Serotonergic synapse
ray04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    107504978 (HTR2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107504978 (HTR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107504978 (HTR2B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    107504978 (HTR2B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107504978 (HTR2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107504978 (HTR2B)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    107504978 (HTR2B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 107504978
NCBI-ProteinID: XP_015990179
LinkDB
Position
Unknown
AA seq 480 aa
MAFFYRISEQSTIPEHILQSSFDHLISSNWSGLQTGSIPEDMKQTGEEQGNKPRWAALLM
LVVIIPTIGGNILVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAMW
PLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQCNSRATAFIKITVVWL
ISIGIALPVPIKGIGTDVGNSHNVTCGLTKERFGNFMLFGSLVSFFIPLAIMIVTYFLTI
HTLQKKAYLVKNKPPQCLTWLTVSTVFQKDETPCSSPEKVAMLNGSHKDKILPNPRGDIL
MRRMSTVGKKSLQTISNEQRASKVLGIVFFLFLLMWCPFFITNVTLVLCDSCNQTTLTML
LEIFMWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATRSVKTLQKCASNIYFRNQM
AENSKFFIKHGRRNGINPAMYQSPMRLRSSTMQSSSIILLDTLLLTENEGDKTEEQVSYV
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggctttcttctatcgaatatctgaacaaagcacaattcctgagcacattttgcagagc
tcatttgatcacttaatctcttctaactggtctggattacagacaggatcgataccagag
gacatgaaacagactggcgaggaacaggggaataaaccgcgctgggcagctcttctgatg
ctcgtggtgataatacccacaattggtggaaacatccttgttattctagccgtttcactg
gagaaaaagctgcagtatgctaccaattattttctaatgtccctggcagtggctgatttg
ctggttggattgtttgtgatgccgattgccctcttgacaataatgtttgaggctatgtgg
cccctcccactggttctatgccctgcctggttatttctggatgttcttttttctactgca
tccattatgcatctctgcgccatttcagtggatcgttatatagccatcaaaaagccaatc
caggccaatcaatgtaactcacgagccacagcgttcatcaagatcacagtggtgtggtta
atttcaataggcattgcgcttccagtccctattaaagggataggaactgacgtgggaaac
tcacataacgtcacttgtgggctgaccaaagaacgtttcggcaatttcatgctctttggc
tcactagtttccttctttatacctctggcaatcatgattgtcacctactttctcaccatc
catactttacaaaagaaagcttacttggtcaaaaacaagccacctcaatgcttaacatgg
ctgactgtgtctacagtgttccaaaaggatgaaacaccttgctcatcgcctgaaaaggtg
gcaatgctgaacggttctcacaaggacaaaattctgcccaacccaagaggtgacatactt
atgcgaagaatgtctacagtaggaaaaaagtcactgcagaccatttccaatgaacaaaga
gcctccaaggttctaggaattgtgtttttcctctttttgctgatgtggtgcccctttttt
attacaaatgtaactttagttttatgtgattcctgcaaccagactactctcacaatgctc
ctggagatattcatgtggataggctacgtttcttcaggggtgaatcctctggtctacact
ctcttcaacaagacattcagggacgcatttggccgatacatcacctgtaattaccgggcc
acgagatcagtaaaaactcttcaaaaatgcgccagtaatatctacttccggaatcaaatg
gcagagaactctaagtttttcataaaacatggaaggagaaatgggattaatcctgccatg
taccagagcccaatgaggctccgaagttcaaccatgcagtcttcttcaatcattctacta
gacacactccttcttaccgaaaatgaaggtgacaaaactgaagagcaagtcagttatgta
tag

DBGET integrated database retrieval system