KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502497
Entry
107502497         CDS       T06036                                 

Gene name
FBXO43
Definition
(RefSeq) F-box only protein 43
  KO
K10318  F-box protein 43
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107502497 (FBXO43)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107502497 (FBXO43)
   03036 Chromosome and associated proteins [BR:ray03036]
    107502497 (FBXO43)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107502497 (FBXO43)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Early mitotic inhibitors
    107502497 (FBXO43)
SSDB
Motif
Pfam: IBR F-box DUF4566 F-box-like
Other DBs
NCBI-GeneID: 107502497
NCBI-ProteinID: XP_015985252
LinkDB
Position
Unknown
AA seq 875 aa
MISNPEKEAKRPKTVVGKNEKWERKSPSDREALLVLCGGWGKGWKLCEGEGETLSSEGGG
RGPARRRAAGGGAAGREEGAARGGAVRSGYSGRAVQTEGGKRGGPTRSWRGGCHSRASLG
ARPWFLLSSPVGAAAPRSPGGRERGTSGVCQLVGLWATPAPRPTLLSRQSKRFSCLEEAC
ITLTSKSSRFTDVGIQKLSFEKMMIEEARLRCQKRHSGQAQTGAGNEVDSPTADFKYSNS
RDLCSTSSFQDSGYSELLKSCGFDNTDKEFSEKKEKGPPLNFSLGSTHPLESPTQKKRFV
FPRKENDKTPELCETPKVRGRKFLLRRRLDISFSLLKGDSESQNSSLESGVSQVLNLEKN
IPSNASGFPRQNNFSALVTSTLKTEEAASSSQKLRLNFSQQKTSTIDDSKDECSLFEVEC
ISPIQGNNFRDSITHDLSDSSLCVNDENTYPELLGSSDSRSTCETDEDIFVTPISNLVAN
IKFKASQRLSPSTEVRGNISTPADSGFNSLCLDKSEDSFSDQEGSFQELLQKHKGTLKVG
SRRLGRLRRLSTLREQGSQSETEEEKQIIHSDSETTPAAASDISGSQLSGDRQSGDLILS
FKNLSKTPALQLVHELFTKSKRKKFQQNSAHEFLEERDRGKIAVLQCVLAGLIGKKMGVE
QLDILTELKYRNLKHILAMVLDSLTAESLCSVWKVSRNWREIIVQDKKANRRRKFYITQL
KTDSEGAILNVQDAATRLHLLNRSALRSVQAQARIPGSQKEQVSTFSPWGEVLTPVASSS
VTHLHSKQEEYVKVAKTLFIDEALKPCPRCQSPAKYQPYKKRGLCSRRACGFDFCVLCLC
AYHGSEECSRGTANSRNRKDALPGSAQSKRNLKRL
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgatatccaatccagaaaaggaagcaaaaaggccaaagactgtggtgggtaaaaatgag
aagtgggagaggaagagcccatcagatagggaggccctcctggtgctttgtggggggtgg
ggaaagggctggaagttgtgcgaaggagagggcgagaccctctcaagcgaaggcggaggg
cggggtcctgcgcggcgcagggcggccggcgggggcgccgcggggcgggaggaaggggcg
gcgcggggaggggcggtgcgtagcggttactcagggcgggcggttcaaaccgaaggaggg
aaacgcggcggccccacgcggagctggcgtgggggttgccatagccgggcctccctgggg
gcgaggccgtggtttctcctcagctcgccggtcggggcggcggcccctcggtctcctggt
gggcgggagcgggggacttcaggtgtgtgccagctagtgggcctctgggcgaccccggcc
ccgcgccccaccttgctttccaggcaaagtaagagattttcttgtttggaagaagcctgt
ataactttgacatctaagagctcaagatttactgatgttggcattcaaaaattaagcttt
gaaaaaatgatgatagaggaagcacgtttgagatgtcagaaaaggcattcaggtcaagct
caaactggagcaggaaatgaggtggactctcctactgccgatttcaagtactccaactcc
agagatttatgttccacatcttcatttcaagatagtggctacagtgagttgttaaaatca
tgcggctttgataatacagataaagaattttctgaaaagaaagaaaaaggcccaccatta
aacttcagtctgggctcaacacatcctttagagtcccctactcaaaaaaagagatttgtc
ttccctagaaaggaaaacgataaaaccccagaactctgtgaaactcccaaagtcagggga
agaaaatttttattgcgcagaaggttggacatatctttctctcttctaaagggggactct
gaatcacaaaatagttccctagaaagtggtgtaagtcaagttctcaacttagaaaaaaat
attccaagcaatgcttcaggttttccaaggcaaaataattttagtgctttagttactagt
actttgaaaacggaagaagcagcttccagcagtcagaaactcagacttaatttttctcag
cagaagacctccacaattgatgactccaaagatgaatgtagcctgtttgaagttgaatgt
atatctccgattcagggcaataattttagagactctatcacccatgacttaagtgatagc
agtctctgtgttaatgatgagaatacatatccagaacttctgggctcctctgatagtagg
tcaacttgtgaaacagatgaggacatttttgtgaccccaataagtaaccttgtagcaaac
attaaatttaaggcaagtcaaagactttctccttcaactgaagtgaggggcaatatttca
acccctgcagacagtggttttaactcactttgcttggataaatcagaagattccttctct
gaccaggagggttcttttcaagaactacttcagaaacataagggaactctcaaagttggg
tcaagacgtctcggaaggttgagaagactgtctactcttcgggagcaaggctcacaatca
gagacagaagaggaaaagcaaatcatccactctgactctgaaacaacaccagcagctgct
tcagacatctcagggagtcagcttagtggtgacaggcagagtggggatttgattttgagc
tttaagaatttatcaaagaccccagccttgcaattagtgcatgagctgtttacgaaaagc
aaaaggaaaaaattccagcaaaacagtgcacatgaattcttagaagaaagggatagaggg
aaaatagctgtgctgcagtgtgtacttgcaggattaattggcaagaaaatgggtgtagaa
caactggacatcttaacagaattaaaatatagaaatttaaagcacattcttgcaatggtt
ttagattccttgactgcagaaagcctatgcagtgtttggaaagtgagcagaaattggcgt
gaaattattgttcaagataaaaaagcaaatcggaggaggaaattttatatcacacaactg
aaaacagattctgagggggctattttaaatgttcaggatgctgccactcggctccatctt
ttaaatcgatccgctttaagatctgtacaagcccaggctaggataccaggttctcagaaa
gaacaagtttcaacattttctccttggggagaagttttgacacctgtagcaagctcttca
gttactcacttacatagtaaacaggaagaatatgttaaggttgccaaaacactttttatc
gatgaagcattaaaaccttgtccaaggtgccaatcccctgctaagtaccagccatataag
aaaaggggactgtgtagccgcagagcctgtggttttgacttttgtgtgttatgtttgtgt
gcttatcatgggtctgaagaatgtagtagaggaacagcaaattcaagaaatagaaaagat
gctcttccaggaagtgcccagagtaagcggaatttaaaacgcctttaa

DBGET integrated database retrieval system