KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502556
Entry
107502556         CDS       T06036                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04115  p53 signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04218  Cellular senescence
ray04934  Cushing syndrome
ray05161  Hepatitis B
ray05162  Measles
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05206  MicroRNAs in cancer
ray05215  Prostate cancer
ray05222  Small cell lung cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107502556 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107502556 (CCNE2)
   04114 Oocyte meiosis
    107502556 (CCNE2)
   04115 p53 signaling pathway
    107502556 (CCNE2)
   04218 Cellular senescence
    107502556 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107502556 (CCNE2)
   05206 MicroRNAs in cancer
    107502556 (CCNE2)
   05203 Viral carcinogenesis
    107502556 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    107502556 (CCNE2)
   05215 Prostate cancer
    107502556 (CCNE2)
   05222 Small cell lung cancer
    107502556 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107502556 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107502556 (CCNE2)
   05161 Hepatitis B
    107502556 (CCNE2)
   05162 Measles
    107502556 (CCNE2)
   05169 Epstein-Barr virus infection
    107502556 (CCNE2)
   05165 Human papillomavirus infection
    107502556 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ray03032]
    107502556 (CCNE2)
   03036 Chromosome and associated proteins [BR:ray03036]
    107502556 (CCNE2)
DNA replication proteins [BR:ray03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    107502556 (CCNE2)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    107502556 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 107502556
NCBI-ProteinID: XP_015985352
LinkDB
Position
Unknown
AA seq 405 aa
MSRRSSRLQAKQQPQPSQTDSSQEVQIIQAKKRKTAQDVKKRQDNEVTKKHQYEIRNCWP
PVLCGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFIDPSPLPDLSWGCSKDVWLNMLK
KETRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKD
INKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEEDILRMELIILKALKWELC
PVTIISWLNLFLQVDALKDAPKVLLPQYSQEKFIQIAQLLDLCILAVDSLEFQYRILAAA
ALCHFTSVEVVKKASGLEWDNISECVDWMVPFVSVVKSTSPVKLKIFKKISMEDRHNIQT
HTNYLAMLDEVNYVKTLRKGGQLSPVCNGGIMTPPKSTEKPPGKH
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgtttacaagctaaacaacagccacagcccagtcagacggat
tcctcccaagaagttcaaataattcaggccaagaagagaaaaacagcccaggatgtcaaa
aaaagacaagacaatgaggtcaccaagaaacatcagtatgagattaggaattgttggcca
cctgtattatgtggggggatcagtccttgcattatcattgaaacaccccacaaagaaata
ggaacaagtgacttctccagatttacaaattacagatttaaaaacctttttattgatcct
tcacctttgcctgatttaagctggggatgttcaaaggatgtttggctaaacatgttaaag
aaagagacccgatatgttcatgacaaacattttgaagttcttcattctgacttggaacca
cagatgaggtcaatacttctagactggcttttagaggtatgtgaagtatacacacttcat
agggaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaaggat
ataaataaaaatatgcttcaactcattggcattacctcattattcattgcttccaaactt
gaggaaatctatgctcctaagctccaagagtttgcttatgtcactgatggtgcttgcagt
gaagaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactttgc
cctgtaacaatcatctcttggctaaatctcttcctccaagttgatgctcttaaagatgct
cctaaagttcttctacctcagtattctcaggaaaagttcatccagatagctcagctttta
gatctgtgtattctagctgtcgattcattagagttccagtacagaatactagctgctgct
gctttgtgccattttacctctgttgaagttgttaagaaagcctcaggtttggaatgggac
aacatttctgaatgtgtagactggatggtgccttttgtgagtgtagtaaaaagtactagt
ccagtgaaattgaagatttttaagaagatttctatggaagacagacacaatatccagaca
catacaaattatctggctatgctggatgaagtaaattatgtaaaaaccctcaggaagggg
ggacagctgtcaccagtgtgcaatggaggcattatgacaccaccgaagagcactgaaaaa
ccaccaggaaaacactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107515884
Entry
107515884         CDS       T06036                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04115  p53 signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04218  Cellular senescence
ray04934  Cushing syndrome
ray05161  Hepatitis B
ray05162  Measles
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05206  MicroRNAs in cancer
ray05215  Prostate cancer
ray05222  Small cell lung cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    107515884 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107515884 (CCNE1)
   04114 Oocyte meiosis
    107515884 (CCNE1)
   04115 p53 signaling pathway
    107515884 (CCNE1)
   04218 Cellular senescence
    107515884 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107515884 (CCNE1)
   05206 MicroRNAs in cancer
    107515884 (CCNE1)
   05203 Viral carcinogenesis
    107515884 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    107515884 (CCNE1)
   05215 Prostate cancer
    107515884 (CCNE1)
   05222 Small cell lung cancer
    107515884 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107515884 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107515884 (CCNE1)
   05161 Hepatitis B
    107515884 (CCNE1)
   05162 Measles
    107515884 (CCNE1)
   05169 Epstein-Barr virus infection
    107515884 (CCNE1)
   05165 Human papillomavirus infection
    107515884 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ray03032]
    107515884 (CCNE1)
   03036 Chromosome and associated proteins [BR:ray03036]
    107515884 (CCNE1)
DNA replication proteins [BR:ray03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    107515884 (CCNE1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    107515884 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C Connexin50
Other DBs
NCBI-GeneID: 107515884
NCBI-ProteinID: XP_016010607
LinkDB
Position
Unknown
AA seq 410 aa
MPRERRERDAKEPGTMKEESGTDASVRSRKRKANVAVFLQDPDEEIAKIDKTVRSQCGSQ
PWDSNPVCENPCSLIPTPDKEEDELVCPSPGHKPQGPRPARAPPLPVLNWANRDEVWKIM
LNKERTYLRDKHFLQRHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
QDVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDDILTMELIIMKALKWH
LSPLTIVSWLSVYLQVAYLNDVYEVLLPQYPQQIFIQIAELLDLCVLDVGCLEFSYGVLA
ASALYHFSSSELMQKVSGYQWCDIEKCVKWMVPFAMVIRETGSSKLKQFRGVPAEDAHNI
QTHLNSLDLLDKAQAKKAILSEQNRVSPLPTGVLTPPPSSKKHSGGQGTA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagaggagggagagggatgccaaggagccgggcaccatgaaagaggaaagt
ggcaccgatgcctctgttcgctccaggaagaggaaggcaaatgtggccgtgtttttgcag
gatccagatgaagaaattgccaaaattgacaagactgtgagaagccagtgtggcagtcag
ccatgggacagtaatccagtctgtgaaaacccctgctccttgatccccacacctgacaaa
gaagaggatgagctggtgtgcccaagccctgggcacaagcctcagggccccaggccagcg
cgagccccacccctgcctgtgctgaactgggcaaatcgagacgaggtctggaaaatcatg
ttaaacaaggaaaggacatacttaagagacaagcactttttacagcggcaccctctcctg
cagccgaaaatgcgagcgattcttctggactggctgatggaggtgtgtgaagtctacaaa
cttcacagagagacgttctacctggcgcaggatttcttcgatcgatatatggcgacgcaa
caagacgtcgtaaaaacgcttttgcagcttattgggatttcgtctttatttattgctgcc
aaacttgaggagatttatcctccaaagctgcaccagttcgcatacgtcacggacggggct
tgctccggagacgacatcctcaccatggagctgatcatcatgaaggctctgaagtggcac
ctcagtcccctgaccatcgtgtcctggctgagcgtctacttgcaggtggcctacctgaac
gacgtgtacgaggtgctcctgccgcagtacccccagcagattttcatacagatcgcagag
ctgttagacctctgcgtcctggatgttggctgcctagaattttcctacggagtccttgct
gcttctgccttgtaccatttctcttcatccgaactgatgcaaaaggtttcagggtatcag
tggtgcgacatagagaagtgcgtcaagtggatggtccccttcgccatggttatcagggag
acagggagttcgaagctgaagcagttccggggcgtgcccgccgaggacgcccacaacatc
cagacccacctgaacagcttggacctgctggacaaagcccaagcgaagaaagccatatta
tctgaacaaaatcgggtctctccgctccccaccggggtcctcaccccgccacccagcagt
aagaagcacagcggcgggcaggggaccgcgtga

DBGET integrated database retrieval system