KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502572
Entry
107502572         CDS       T06036                                 

Gene name
LIPE
Definition
(RefSeq) hormone-sensitive lipase isoform X1
  KO
K07188  hormone-sensitive lipase [EC:3.1.1.79]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04152  AMPK signaling pathway
ray04371  Apelin signaling pathway
ray04714  Thermogenesis
ray04910  Insulin signaling pathway
ray04923  Regulation of lipolysis in adipocytes
ray04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107502572 (LIPE)
   04024 cAMP signaling pathway
    107502572 (LIPE)
   04152 AMPK signaling pathway
    107502572 (LIPE)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    107502572 (LIPE)
   04923 Regulation of lipolysis in adipocytes
    107502572 (LIPE)
   04925 Aldosterone synthesis and secretion
    107502572 (LIPE)
  09159 Environmental adaptation
   04714 Thermogenesis
    107502572 (LIPE)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.79  hormone-sensitive lipase
     107502572 (LIPE)
SSDB
Motif
Pfam: HSL_N Abhydrolase_3 Say1_Mug180 COesterase
Other DBs
NCBI-GeneID: 107502572
NCBI-ProteinID: XP_015985384
LinkDB
Position
Unknown
AA seq 809 aa
MESAWGAGPVGAAGAGGALASKRDKEGSKSRSRRRWRKVKAKAPVLLHSMDLRTMTQSLV
TLAEDNMAFFSSQGPGETARRLLGVFAGVREQALALEPALGHLLGVAHLFDLDAETPANG
YRSLVHTARCCLAHLLHKSRYVAANRRSIFFRTSHNLAELEAYLAALTQLRALTYCAQRL
LASNQPGGLFFEGDEGLAADFLREYVTLHKGCFYGRCLGFQFTPAIRPFLQTISIGLVSF
GEHYKRNETGLSVTASSLFTGGRFAIDPELRGAEFERITQNLDVHFWKAFWNITEIEVLS
SLANMASATVRVSRLLSLPPEAFEMPLTADPKLMVTISPPLAHTGPGPVLVRLISYDLRE
GQDSEQLNSLVKSEGSRSLELWPRPQQAPRSPSLVVHIHGGGFVAQTSKSHEPYLKSWAQ
ELGVPILSIDYSLAPEAPFPRALEECFYAYCWAVKHCALLGSTGERICLAGDSAGGNLCF
TVSLRAAAYGVRVPDGIMAAYPATMLQFTASPSRLLSLMDPLLPLSVLSKCVSAYAGAET
EDHSNSDQKALGMMGLVRRDTALLLRDLRLGASSWLNSFLELSGHKSQPKSVPIAEPVRR
SVSEAALAQPEDPVGTDPLKSLTIHDLSLRGNSETSDTPELSLSDETLGPSTPSDVNFLL
RPEDTPEKVESQEEMSTKDGSSSCLSGTFPEDFLPRRSSQGPTQIPLYSSPIAKNPFMSP
LLAPDSMLQTLPPVHIVACALDPILDDSVMFARRLRSLGKPVTLRVVEDLPHGFLSLASL
CRETRQAAALCVERIRQILTPPGPAAPPV
NT seq 2430 nt   +upstreamnt  +downstreamnt
atggagtcagcctggggagcggggcccgttggggccgcaggggccggtggagccctggcc
tcgaagagggacaaagaggggtccaagagtcgtagccgccggcggtggagaaaagtcaag
gccaaagccccggtgctcttgcacagcatggacctgcgcacaatgacacagtcgctggtg
actctggcggaagacaacatggccttcttctcgagccaaggacctggggagacagcacgg
cggctgttgggcgtctttgcgggtgttcgggagcaggcgttggcgctggagccagccctg
ggccacctgctgggtgtggcacacctctttgacctggacgcagagacgccggccaatggg
taccgcagcctggtgcacacggcccgctgctgcctggcgcacctgctgcacaaatcccgc
tacgtggccgccaaccgccgcagcatcttcttccgcaccagccacaacctggctgaactc
gaggcctacctggccgctctcacccagctccgcgccctgacctactgtgcccagcgcctg
ctggccagcaaccagccagggggactcttctttgagggcgacgaggggctcgccgccgac
ttcctgcgcgagtacgtcactctgcacaagggctgcttctatggccgctgcctgggcttc
cagttcacacctgccatcaggccattcctgcagaccatctccattgggctcgtgtccttc
ggggagcactacaaacgcaacgaaaccggactcagtgtgaccgccagctccctcttcacc
ggtggccgctttgccattgacccagagctgcgtggggccgaatttgagcgaatcactcag
aacctggacgtacacttctggaaagccttctggaatatcactgagatcgaggtgctgtcg
tctctagcaaacatggcatcagccaccgtgagggtaagccgcctgctcagcctgccacca
gaggcctttgaaatgccgctgaccgctgaccccaagctcatggtcaccatctcacccccc
ttggcccacacgggccccgggccagtcctcgtcaggctcatctcctatgatctgcgtgaa
ggacaggacagtgagcagctcaacagcctggtgaagtctgagggttcaaggagcctggaa
ctgtggcctcggccgcagcaggcgccccgctcaccatccctggtcgtgcatatccacggt
ggcggcttcgtggcccagacctccaaatcccacgagccctacctcaagagctgggcccag
gagctgggtgtccccatcctctccatcgactactccctggcccccgaggcccccttcccc
cgagcgctggaagagtgcttctatgcctactgctgggctgtcaagcactgcgccctcctc
ggttcaacgggtgaacggatatgccttgcaggcgacagtgcaggtgggaacctctgcttc
accgtctcccttcgggcagcagcctatggggtgcgggtgccagacggcatcatggcagcc
tacccagccacgatgctgcagttcaccgcctctccctcccgccttctgagcctcatggac
ccgctgctgcccctcagcgtgctctccaagtgtgtcagtgcctatgctggtgcggagaca
gaggaccactccaactcagaccagaaagcactgggcatgatggggctggtgcggcgggac
acagccctgctcctccgggacctccgcctgggcgcctcctcgtggctcaactccttcctg
gagctgagcgggcacaagtctcaacccaaatcggtgcccatagcagagccagtgcgccgc
agtgtgtccgaagcagcgctggcccagcctgaggacccggtgggcacagaccccctcaag
agcctgacaatacatgacctgagcctcaggggcaactctgagacatcagacacccccgag
ctgtcactgtcggatgagacacttggcccctccacgccctcagacgtcaacttcttactc
cggcctgaggatacaccagaaaaagttgagtcccaagaggagatgagcaccaaggacgga
agcagcagctgtctcagtggcaccttccctgaggacttccttcccaggcgctccagccag
ggccccacgcagatccccctctactcatcgcccatcgccaagaaccccttcatgtcaccg
ctgctggcacctgacagcatgctgcagacactaccgccagtacacatcgtggcgtgcgcg
ctggaccccatactggacgactcggtcatgtttgcaaggcggctgcgcagcctcggcaag
ccggtgacgctgcgcgtggtggaggacctgccgcacggcttcctgagcctggcgtccctg
tgtcgggaaacgcggcaggcagccgcgctgtgcgtggaacgcatccgccaaatcctcact
ccgcccggccccgctgcgccgccggtctga

DBGET integrated database retrieval system