KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502626
Entry
107502626         CDS       T06036                                 

Gene name
LPAR1
Definition
(RefSeq) lysophosphatidic acid receptor 1
  KO
K04289  lysophosphatidic acid receptor 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04072  Phospholipase D signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04151  PI3K-Akt signaling pathway
ray04540  Gap junction
ray04810  Regulation of actin cytoskeleton
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107502626 (LPAR1)
   04072 Phospholipase D signaling pathway
    107502626 (LPAR1)
   04151 PI3K-Akt signaling pathway
    107502626 (LPAR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107502626 (LPAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107502626 (LPAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107502626 (LPAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107502626 (LPAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107502626 (LPAR1)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    107502626 (LPAR1)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 107502626
NCBI-ProteinID: XP_015985510
LinkDB
Position
Unknown
AA seq 364 aa
MAAASTSTPVISQPQFTAMNEPQCFYNESIAFFYNRSGKYLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENTSGPTEGSDRSASSLNHTILAGVHSND
HSVV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggccgctgcctccacttccacccctgtaatttcacagccccagttcacagccatgaat
gaaccacagtgcttctacaatgagtccatcgccttcttttataaccggagtggaaagtat
cttgcgacagaatggaacacagtcagcaaactggtgatgggactgggaatcaccgtgtgc
atcttcatcatgttggccaacctcctggtcatggtggcaatctacgtcaaccgccgcttc
cattttcctatttattacttaatggctaatctggccgctgcagacttctttgccgggttg
gcctacttctacctaatgttcaacacaggacctaatactcggagactgactgttagcacg
tggctccttcgtcagggcctcatagataccagcctgacggcatctgtggcgaatttactg
gctattgcaattgagaggcacattacggttttccgcatgcagctccacacacggatgagc
aaccggagggtggtggtggtgatcgtggtcatctggactatggccattgttatgggtgct
atccccagcgtgggctggaattgcatctgtgatattgaaaattgttccaacatggcaccc
ctctacagtgactcttatttagtcttctgggccattttcaacttggtgacctttgtcgtc
atggtggttctctatgctcacatttttggttatgttcgccagaggactatgagaatgtct
cgacatagttctggaccccggcggaatcgtgataccatgatgagtcttctgaagactgtg
gtcattgtgcttggtgcctttatcatctgctggacccctggactggtcttactacttctg
gacgtgtgctgtccacagtgcgatgttctggcctatgagaaattcttccttctgctcgct
gagttcaactctgccatgaatcccatcatctactcctaccgggacaaggagatgagcgcc
accttcagacagatcctctgctgccagcgcagtgagaacaccagcggccccaccgaaggc
tcagaccgttcagcttcttccctcaaccacaccatcttggccggagttcacagcaatgac
cactccgtggtttag

DBGET integrated database retrieval system