KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502656
Entry
107502656         CDS       T06036                                 

Gene name
BCAR1
Definition
(RefSeq) breast cancer anti-estrogen resistance protein 1 isoform X1
  KO
K05726  breast cancer anti-estrogen resistance 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04062  Chemokine signaling pathway
ray04510  Focal adhesion
ray04670  Leukocyte transendothelial migration
ray04810  Regulation of actin cytoskeleton
ray04935  Growth hormone synthesis, secretion and action
ray05100  Bacterial invasion of epithelial cells
ray05135  Yersinia infection
ray05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107502656 (BCAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107502656 (BCAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107502656 (BCAR1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    107502656 (BCAR1)
   04062 Chemokine signaling pathway
    107502656 (BCAR1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    107502656 (BCAR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107502656 (BCAR1)
   05100 Bacterial invasion of epithelial cells
    107502656 (BCAR1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    107502656 (BCAR1)
SSDB
Motif
Pfam: CAS_C Serine_rich SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 107502656
NCBI-ProteinID: XP_015985553
LinkDB
Position
Unknown
AA seq 867 aa
MNYLNVLAKALYDNVAESPDELSFRKGDIMTVLERDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMHDKKPAGPGPGPPAPSAPPQPGLHNPATQYTSMLPTSYPPQPDSVYLVPTPSKT
QQGLYQAPGPSPQFQSPPAKQTSTFLKQMPHHPFPSPAPDLYQVPPGPGSPAQDIYQVPP
SAGIGHDIYQVPPSMDARSWEGTKPPAKVVVPTRMGQGYVFEASQPEQDEYDIPRHLLGP
GPQDIYDVPPVRGLLPSQYSQEVYDTPPMAVKGPNGRDPSLDVYDVPPSVEKGLPPSSHR
AVYDVPPSVSKDMPDGPLLREETYDVPPAFAKAKPFDPARHPLVLAAPPPDSPPAEDVYD
VPPPAPDLYDVPPGLRRPGPGTLYDVPRERLLPPEAADSSVADDGVYAVPPPAEREAPAD
GKRLSASSTGSTRSSQSASSLETAVAGREPLELEVAVEALGRLQQGVSATVAHLLDVAGS
AGGCGGWRSTAEPQEPPVQDLRAAVTAVQGAVHELLEFARSAVGNAAHTSDRTLHAKLSR
QLQKMEDVYQTLVAHGQTFDSARGGPGATPEDLDRLVACSRAVPEDTKQLASFLHGNASL
LFRRTKAPVSGPEGGGPLHPNPTDKASSIQSRPLPSPPKFTSQDSPDGQYENSEGGWMED
YDYVHLQGKEEFEKTQKELLEKGNIMRQGKGQLELQQLKQFERLEQEVSRPIDHDLTNWT
TAQALAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVAHSK
FVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSPTAA
QDMVDRVRELGHSTQQFRRVLGQLAAA
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgaactacctgaatgtgctggccaaagccctctatgacaacgtggctgagtccccggat
gagctctccttccgcaagggcgatatcatgacggtgctggagcgggacacacagggcctg
gacggctggtggctctgctcgctgcacgggcgccaaggcatcgtgcctgggaaccgcctc
aagatcctggtgggcatgcacgacaagaagccagcagggcccggccccggccctcccgcc
ccctctgccccaccccagcctggtctccacaacccggccacccagtacacgtccatgctg
cccacctcatacccaccgcagcccgacagcgtctacctggtgcccacccccagcaagact
cagcagggcctctaccaagcccctgggcccagcccacagttccagtctcccccagccaag
cagacgtccacgttcctgaagcagatgccccatcacccatttcccagcccagccccagac
ctttaccaggtgcccccagggcccggcagcccagcccaggacatttaccaggtgccacct
tccgctgggatagggcacgacatctaccaggtccccccgtccatggatgcacgcagctgg
gaggggacgaagccgccggcaaaggtggtggtgcccacccgcatgggacagggctatgtg
ttcgaggcctcccagccagagcaggatgagtacgacatcccacgccacctgctgggcccc
gggccccaggacatctatgacgtgccgcctgttcgggggctgcttcccagccagtatagc
caggaggtatatgacactccccccatggctgtcaagggtcccaacggccgggacccgtcg
ctggatgtctatgacgtgccccccagtgtggagaagggcctgccgccatccagccatcgt
gcggtgtatgatgttcctccatcagtgagcaaggacatgcccgacggcccactgctgcgt
gaggagacctacgatgtgccccctgccttcgccaaggccaagccctttgacccagcccgc
cacccgctggtccttgctgctccgcccccggactcaccacccgctgaggatgtgtacgac
gtgccgccacctgctcccgacctttacgatgtgccccctggcttgcggcggcctggcccc
ggcaccctctacgacgtgccccgtgagcggctccttccgcctgaggcagccgacagcagc
gtggccgatgacggcgtgtacgccgtgcccccgcccgccgagcgagaggccccggccgat
ggcaagcgcctgtcagcctccagcacgggcagcacacgcagcagccagtccgcctcctcc
ctggagacggcggtcgcgggccgcgagcccctggagctggaggtggccgtggaggccctg
ggccggctgcagcagggcgtgagtgccaccgtagcccacctcttggacgtggcgggcagt
gctggtgggtgcgggggctggcgcagcaccgccgagcctcaggagcccccggtgcaggac
ctgcgggccgctgtgactgctgtccagggggctgtccacgagctgctggagtttgcccgc
agcgctgtgggcaacgccgcgcacacttctgaccgcacgctgcatgccaagcttagccgg
caactgcagaagatggaggacgtgtaccagacgttggtggcccatggtcagacctttgac
agtgcccgcggtggccccggggccactcctgaagacctagaccgcttggtggcctgctca
cgggctgtgccagaggacaccaagcagctggcttccttcttgcatggcaatgcctcgctg
cttttcagacggaccaaggcccctgtctcagggcccgaggggggcggccccctgcacccc
aaccccaccgacaaggccagcagcatccagtcccggcccttgccctcaccccccaagttc
acctcgcaggactccccagacgggcagtacgagaacagcgaggggggctggatggaagat
tacgactacgtccacctgcaggggaaggaagagtttgagaagacccagaaggagctgttg
gaaaagggcaacatcatgcggcaggggaagggccagctggagctgcagcagctgaagcag
ttcgagcggctggagcaggaggtgtcgcgacccatagaccacgacctgaccaactggaca
acggcccaggccctggccccggggcggacaggtggcctggggccatcggatcggcagctg
ctgctcttctacctggagcagtgtgaggcaaacctgaccacgctgaccaacgcggtggac
gccttctttaccgccgtggccaccaaccagccgcccaagatcttcgtggcacacagcaag
ttcgtcatcctcagcgcccacaagctggtgttcattggggacacgctgtcgcgacaggcc
aaggcagctgacgtgcgtagccaggtgactcactacagcaaccttctgtgcgacctcctg
cgtggcattgtggccaccaccaaggccgctgccttgcagtacccgtcgcccaccgccgcc
caggacatggtggacagggtcagggagctgggccacagcacccagcaattccgccgggtc
ctgggccagttggcagctgcctga

DBGET integrated database retrieval system