KEGG   Rousettus aegyptiacus (Egyptian rousette): 107502774
Entry
107502774         CDS       T06036                                 

Gene name
NPR2
Definition
(RefSeq) atrial natriuretic peptide receptor 2 isoform X1
  KO
K12324  atrial natriuretic peptide receptor B [EC:4.6.1.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107502774 (NPR2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107502774 (NPR2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107502774 (NPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107502774 (NPR2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107502774 (NPR2)
Enzymes [BR:ray01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     107502774 (NPR2)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   107502774 (NPR2)
SSDB
Motif
Pfam: Guanylate_cyc ANF_receptor PK_Tyr_Ser-Thr Pkinase HNOBA
Other DBs
NCBI-GeneID: 107502774
NCBI-ProteinID: XP_015985765
LinkDB
Position
Unknown
AA seq 1050 aa
MALPSLLLVVAALAGGVRPPLARNLTLAVVLPEHNLSYAWAWPRVGPAVALAVEALGRAL
PVDLRFVSSELDGACSEYLAPLRAVDLKLYHDPDLLLGPGCVYPAASVARFASHWHLPLL
TAGAVASGFAAKNEHYRTLVRTGPSAPKLGEFVVTLHGHFNWTARAALLYLDARTDDRPH
YFTIEGVFEALQGSNLSVQHQVYAREPGGPEQATHFIRSNGRIVYICGPLEMLHEILLQA
QRENLTNGDYVFFYLDVFGESLRAGPTRSTGRPWQDNRTWEQAQALREAFQTVLVITYRE
PPNPEYQEFQNRLLIRAREDFGVELTPSLMNLIAGCFYDGILLYAEVLNETIQEGGTRED
GLRIVEKMQGRRYHGVTGLVVMDKNNDRETDFVLWAMGDLDSGDFQPAAHYSGAEKQIWW
TGRPIPWVKGAPPLDNPPCAFDLDDPSCDKTPLSTLAIVALGTGITFIMFGVSSFLIFRP
YRKLMLEKELASMLWRIRWEELQFGNSERYHKGAGSRLTLSLRGSSYGSLMTAHGKYQIF
ANTGHFKGNVVAIKHVNKKRIELTRQVLFELKHMRDVQFNHLTRFIGACIDPPNICIVTE
YCPRGSLQDILENDSINLDWMFRYSLINDLVKGMAFLHNSIIASHGSLKSSNCVVDSRFV
LKITDYGLASFRSTAEPDDSHALYAKKLWTAPELLSGNPLPTTGMQKADIYSFGIILQEI
ALRSGPFYLEGLDLSPKEIVQKVRNGQRPYFRPSIDRTQLNEELVLLMERCWAQDAAERP
DFGQIKGFIRRFNKEGGTSILDNLLLRMEQYANNLEKLVEERTQAYLEEKRKAEALLYQI
LPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAII
DNFDVYKVETIGDAYMVVSGLPGRNGQRHAPEIARMALALLDAVSSFRIRHRPHDQLRLR
IGVHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGQALKIHVSSTTKDALDELGCFQL
ELRGDVEMKGKGKMRTYWLLGEQKGSAGLL
NT seq 3153 nt   +upstreamnt  +downstreamnt
atggcactgccatcactcctgctggtggtggcagccctggcaggtggggtgcgtcctcct
ttggcgcggaacctgacgctggcggtagtgctgccagaacacaacctgagctatgcctgg
gcctggccacgggtaggtcctgctgtggcactagctgtggaggcactgggccgggcactg
cccgtggacctgcggtttgtcagctctgaactagatggcgcctgctctgagtacctggca
ccgctgcgcgctgtggacctcaagctgtaccatgaccctgaccttctgttgggccctggt
tgtgtgtaccccgctgcctctgtggcccgctttgcctctcattggcaccttcccctgctg
actgcgggtgctgtggcctctggttttgcggctaagaatgagcattatcgaaccctggtg
cgcactggtccctctgctcccaagctgggtgagtttgtagtgacattacacgggcacttc
aattggactgcccgtgctgccttgctgtatctggatgctcgcacagatgaccggcctcac
tacttcaccatcgagggcgtctttgaggccctgcagggcagcaacctcagtgtgcagcac
caggtgtatgcccgtgagccagggggccctgagcaggccacccacttcatccggtccaac
gggcgcattgtatatatctgtggccctctggagatgctgcatgagatcctgctgcaggcc
cagagggagaacctgaccaatggggattatgtcttcttttacctggatgtctttggggag
agtctccgtgcaggccccacgcgctctacaggccggccctggcaggacaatcgcacctgg
gaacaggctcaggccctcagagaggcctttcagacagttttggtcatcacatatcgtgaa
cccccaaatcctgagtatcaggaattccagaatcgtttgctgataagagcccgggaagat
tttggtgtggagctgaccccctccttgatgaacctcatcgctggctgtttctacgatggg
atcctgctttatgccgaagtcttgaacgagacaatacaggaaggaggcacccgggaagat
ggacttcgaattgtggaaaagatgcagggacgaagataccatggtgtaactggattggtt
gttatggacaagaacaatgatcgggagactgattttgtcctgtgggccatgggagacctg
gattctggggactttcagcctgcagcccactactcaggagccgagaagcagatttggtgg
acaggacggccaatcccctgggtgaagggggcgccccccttggataaccccccctgtgcc
tttgacttggacgacccatcctgtgataaaactccactttcaactctggcaattgtggca
ctgggcacaggaatcaccttcatcatgtttggtgtttccagctttctcattttccgtcct
tacagaaaactgatgctggagaaggagctggctagcatgctgtggcgcattcgctgggaa
gagctgcaatttggcaattcagagcgatatcataaaggtgcaggcagtcgtctcacactg
tcactgcggggatccagttacggctcgctcatgacagcccatgggaaataccagatcttt
gccaacaccggtcatttcaagggaaatgttgttgcaatcaaacatgtcaataagaagcgc
attgagctgacccggcaggttctgtttgaactcaaacatatgagagatgttcagttcaac
catctcacccgcttcattggtgcttgcatagaccctcccaacatttgcatcgtcactgaa
tattgtcctcgtgggagtttacaggatattctggaaaatgacagcatcaacttggactgg
atgtttcgttattcactcattaatgaccttgttaagggcatggcctttctccataacagc
attattgcatcccatgggagtctcaagtcctccaactgtgtggtggatagtcgttttgtg
ctcaaaatcacagactatggcctggccagcttccgatcaactgctgaacctgatgacagt
cacgccctctatgccaagaagctgtggactgccccagaactgctcagtgggaaccccttg
ccaaccacaggcatgcagaaagcggatatctatagctttgggatcatcttacaggagata
gcacttcgcagtggtcctttctacttggagggcctggacctcagccccaaagagattgtc
cagaaggtcagaaatggtcagcggccatatttccggcccagcattgaccggacccaactg
aatgaagagttagttttgctaatggaacgatgttgggcccaggatgcagcggaacggcca
gactttggacagattaagggcttcattcgccgctttaacaaggagggtggcaccagcata
ctggacaacctcctgttgcgtatggagcagtatgccaataacctggagaagctggtggag
gaacgcacacaggcctatctggaggagaaacgcaaggctgaggctctgctctaccaaatt
ctaccccattcagtagcagagcagttaaaacggggagagactgtacaggccgaggccttt
gacagtgttaccatctacttcagtgacatcgttggcttcacagctttgtcagcagagagc
actcccatgcaggtggtgacacttcttaatgacctgtatacctgctttgatgccataatt
gacaactttgacgtctacaaggtagaaactataggagatgcctacatggtggtatctggt
ctcccaggccgaaatggtcaacgccacgccccggaaattgctcgtatggccctagcatta
ctggatgcagtttcctctttccgcattcgccaccgaccccatgaccagctgaggctacgt
ataggggtacacacagggcctgtctgtgctggggtcgttggcctgaagatgccccgctat
tgtctttttggagacacggtaaacactgcttcccgaatggagtctaatggtcaagccctg
aagatccatgtctcctctaccaccaaggatgccctggatgagctaggatgcttccagcta
gagcttcggggggatgtggagatgaagggaaaaggaaagatgcgaacttactggctccta
ggagagcagaaaggatctgctggacttctgtaa

DBGET integrated database retrieval system